Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NE06

Protein Details
Accession A0A2T2NE06   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-104DVVESKALKRKRKRKAALEEEMEYHydrophilic
NLS Segment(s)
PositionSequence
87-96ALKRKRKRKA
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025124  DUF4050  
Pfam View protein in Pfam  
PF13259  DUF4050  
Amino Acid Sequences MDINQTATRSARRFLDERVRNDWDWPNTPDFWSHSDEEVRGATEFRERYYGDSSDRDRDSDNDGGATANPYKFDSPDAIGDVVESKALKRKRKRKAALEEEMEYNEGLVCFVRRRDAWTGAAAVQKYGIHHTTDEPKVQDESLSTAETLETADAEEPAAKGDPPPTVETLCPLAPTLLAGNAVRNSIGPKTYSDIYNKVVMSSRTPSVPINLSDMTKALVQGWKDSGEWPPKAAPLDPLVGRKKAFASKRAPVSVRADNHDGPFLSHHPHMKKGMESVKRILHLNGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.53
4 0.55
5 0.59
6 0.6
7 0.55
8 0.58
9 0.58
10 0.53
11 0.51
12 0.49
13 0.46
14 0.41
15 0.42
16 0.39
17 0.35
18 0.32
19 0.31
20 0.29
21 0.28
22 0.3
23 0.29
24 0.28
25 0.25
26 0.22
27 0.18
28 0.16
29 0.14
30 0.18
31 0.18
32 0.18
33 0.21
34 0.2
35 0.23
36 0.27
37 0.29
38 0.26
39 0.31
40 0.34
41 0.37
42 0.37
43 0.35
44 0.32
45 0.31
46 0.34
47 0.3
48 0.27
49 0.2
50 0.19
51 0.18
52 0.17
53 0.18
54 0.15
55 0.13
56 0.13
57 0.14
58 0.15
59 0.15
60 0.17
61 0.16
62 0.15
63 0.16
64 0.17
65 0.16
66 0.14
67 0.14
68 0.13
69 0.11
70 0.1
71 0.08
72 0.07
73 0.14
74 0.21
75 0.3
76 0.39
77 0.49
78 0.59
79 0.7
80 0.79
81 0.82
82 0.87
83 0.87
84 0.85
85 0.8
86 0.72
87 0.62
88 0.53
89 0.43
90 0.32
91 0.22
92 0.14
93 0.09
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.1
100 0.1
101 0.15
102 0.19
103 0.22
104 0.23
105 0.23
106 0.24
107 0.23
108 0.25
109 0.2
110 0.16
111 0.13
112 0.12
113 0.12
114 0.13
115 0.12
116 0.1
117 0.11
118 0.13
119 0.18
120 0.2
121 0.21
122 0.19
123 0.19
124 0.19
125 0.19
126 0.17
127 0.11
128 0.11
129 0.11
130 0.1
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.05
137 0.03
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.05
145 0.05
146 0.05
147 0.05
148 0.07
149 0.08
150 0.1
151 0.11
152 0.12
153 0.13
154 0.13
155 0.14
156 0.15
157 0.14
158 0.12
159 0.11
160 0.09
161 0.08
162 0.08
163 0.07
164 0.05
165 0.07
166 0.06
167 0.08
168 0.08
169 0.09
170 0.08
171 0.08
172 0.09
173 0.09
174 0.1
175 0.1
176 0.1
177 0.14
178 0.16
179 0.18
180 0.2
181 0.22
182 0.23
183 0.26
184 0.25
185 0.23
186 0.24
187 0.22
188 0.22
189 0.22
190 0.22
191 0.18
192 0.2
193 0.19
194 0.19
195 0.21
196 0.19
197 0.2
198 0.2
199 0.2
200 0.19
201 0.18
202 0.17
203 0.14
204 0.13
205 0.11
206 0.12
207 0.12
208 0.14
209 0.16
210 0.16
211 0.16
212 0.17
213 0.22
214 0.27
215 0.27
216 0.27
217 0.27
218 0.28
219 0.29
220 0.29
221 0.25
222 0.2
223 0.24
224 0.25
225 0.31
226 0.32
227 0.34
228 0.34
229 0.33
230 0.35
231 0.38
232 0.41
233 0.42
234 0.45
235 0.5
236 0.57
237 0.62
238 0.6
239 0.57
240 0.58
241 0.58
242 0.54
243 0.52
244 0.5
245 0.46
246 0.46
247 0.44
248 0.38
249 0.31
250 0.3
251 0.27
252 0.26
253 0.27
254 0.33
255 0.33
256 0.39
257 0.43
258 0.43
259 0.44
260 0.47
261 0.53
262 0.52
263 0.54
264 0.54
265 0.55
266 0.54
267 0.53
268 0.46