Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NTT2

Protein Details
Accession A0A2T2NTT2   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-84KKGSPEPKSTGKKKNEEEQEBasic
NLS Segment(s)
PositionSequence
61-78KNEPKKGSPEPKSTGKKK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPKLREKVKEDVKNETNKDGGGKGQWSAWKAAKLSKEYEKKGGSYENEAGSKNEPKKGSPEPKSTGKKKNEEEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.72
4 0.71
5 0.74
6 0.67
7 0.67
8 0.63
9 0.65
10 0.62
11 0.55
12 0.45
13 0.37
14 0.35
15 0.27
16 0.22
17 0.15
18 0.14
19 0.12
20 0.14
21 0.15
22 0.15
23 0.17
24 0.18
25 0.19
26 0.19
27 0.22
28 0.23
29 0.23
30 0.26
31 0.31
32 0.36
33 0.36
34 0.42
35 0.39
36 0.36
37 0.36
38 0.37
39 0.3
40 0.29
41 0.3
42 0.26
43 0.27
44 0.27
45 0.26
46 0.25
47 0.31
48 0.29
49 0.32
50 0.3
51 0.3
52 0.36
53 0.45
54 0.51
55 0.52
56 0.57
57 0.57
58 0.66
59 0.75
60 0.77
61 0.77
62 0.76
63 0.78
64 0.77