Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2N2B0

Protein Details
Accession A0A2T2N2B0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAVRKATNKVHNKKLRRRREGLLTKAYHydrophilic
NLS Segment(s)
PositionSequence
10-19VHNKKLRRRR
83-94KRVEETRRKQKK
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MAVRKATNKVHNKKLRRRREGLLTKAYEYGELDGVELALFIRYPKRGEFYYYTSREGLPWLRDVEEKMAHPKAKRECTENVKKRVEETRRKQKKLRSVSLWRDEASDCHEDSPWAVHADAFPEFLFDIATLKALLKMRPRVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.86
5 0.82
6 0.84
7 0.83
8 0.8
9 0.79
10 0.71
11 0.63
12 0.59
13 0.52
14 0.41
15 0.32
16 0.25
17 0.17
18 0.14
19 0.12
20 0.09
21 0.09
22 0.08
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.07
29 0.09
30 0.11
31 0.12
32 0.16
33 0.17
34 0.22
35 0.25
36 0.29
37 0.37
38 0.38
39 0.39
40 0.36
41 0.35
42 0.31
43 0.29
44 0.26
45 0.18
46 0.17
47 0.16
48 0.16
49 0.17
50 0.17
51 0.18
52 0.16
53 0.16
54 0.18
55 0.21
56 0.22
57 0.22
58 0.28
59 0.32
60 0.37
61 0.38
62 0.38
63 0.41
64 0.47
65 0.58
66 0.6
67 0.61
68 0.58
69 0.57
70 0.56
71 0.59
72 0.59
73 0.59
74 0.61
75 0.64
76 0.7
77 0.75
78 0.78
79 0.76
80 0.77
81 0.76
82 0.75
83 0.72
84 0.72
85 0.76
86 0.78
87 0.73
88 0.63
89 0.55
90 0.47
91 0.39
92 0.34
93 0.27
94 0.2
95 0.18
96 0.18
97 0.16
98 0.16
99 0.17
100 0.14
101 0.13
102 0.12
103 0.12
104 0.12
105 0.14
106 0.14
107 0.13
108 0.11
109 0.1
110 0.1
111 0.1
112 0.1
113 0.07
114 0.08
115 0.07
116 0.08
117 0.07
118 0.08
119 0.13
120 0.15
121 0.2
122 0.26
123 0.35