Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NK80

Protein Details
Accession A0A2T2NK80   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
140-164VNGARNKEPIKKKPNRRDKAVDMEKBasic
NLS Segment(s)
PositionSequence
145-157NKEPIKKKPNRRD
Subcellular Location(s) nucl 16.5, cyto_nucl 12.666, mito_nucl 10.833, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027353  NET_dom  
IPR038336  NET_sf  
IPR016665  Sas5/TAF14  
IPR038704  YEAST_sf  
IPR005033  YEATS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003743  F:translation initiation factor activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF17035  BET  
PF03366  YEATS  
PROSITE View protein in PROSITE  
PS51037  YEATS  
CDD cd16905  YEATS_Taf14_like  
Amino Acid Sequences MPDIKRTVKLITQQRVIPNEPAPMEGYLMRNWSIEIWLLDENGNEVMPNVFEKATYNLHPSFEKNKQVFKKPPFRIEEKGWGEFDMTIVLTSLHKGGDHTLEHDLNFQAERYEAKHQITFRNPKSELVQLLAESGPAGDVNGARNKEPIKKKPNRRDKAVDMEKLADGLQKLGEDDLLQVVTMVHDNKSHETYTKNDVENGEFHVDLYTLPDSLVKMLWEFTASKVEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.58
4 0.54
5 0.47
6 0.43
7 0.39
8 0.35
9 0.3
10 0.25
11 0.24
12 0.21
13 0.21
14 0.17
15 0.19
16 0.18
17 0.16
18 0.16
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.12
25 0.13
26 0.13
27 0.12
28 0.12
29 0.11
30 0.1
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.07
38 0.07
39 0.09
40 0.12
41 0.16
42 0.17
43 0.21
44 0.21
45 0.23
46 0.25
47 0.27
48 0.31
49 0.34
50 0.41
51 0.39
52 0.46
53 0.51
54 0.58
55 0.63
56 0.65
57 0.7
58 0.67
59 0.73
60 0.69
61 0.69
62 0.65
63 0.61
64 0.62
65 0.56
66 0.52
67 0.44
68 0.39
69 0.34
70 0.28
71 0.23
72 0.13
73 0.09
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.09
85 0.1
86 0.11
87 0.14
88 0.14
89 0.14
90 0.15
91 0.14
92 0.11
93 0.11
94 0.09
95 0.06
96 0.06
97 0.07
98 0.08
99 0.13
100 0.15
101 0.16
102 0.19
103 0.2
104 0.25
105 0.32
106 0.38
107 0.36
108 0.41
109 0.41
110 0.4
111 0.41
112 0.38
113 0.31
114 0.25
115 0.23
116 0.15
117 0.15
118 0.14
119 0.11
120 0.08
121 0.07
122 0.05
123 0.04
124 0.04
125 0.03
126 0.04
127 0.07
128 0.11
129 0.12
130 0.12
131 0.15
132 0.18
133 0.26
134 0.34
135 0.41
136 0.48
137 0.57
138 0.68
139 0.76
140 0.85
141 0.84
142 0.84
143 0.83
144 0.79
145 0.8
146 0.77
147 0.7
148 0.6
149 0.55
150 0.46
151 0.39
152 0.31
153 0.22
154 0.14
155 0.11
156 0.1
157 0.08
158 0.08
159 0.08
160 0.08
161 0.06
162 0.07
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.08
170 0.09
171 0.09
172 0.11
173 0.14
174 0.17
175 0.2
176 0.21
177 0.21
178 0.22
179 0.25
180 0.31
181 0.35
182 0.33
183 0.33
184 0.34
185 0.34
186 0.33
187 0.33
188 0.29
189 0.22
190 0.21
191 0.18
192 0.17
193 0.14
194 0.16
195 0.13
196 0.1
197 0.1
198 0.11
199 0.11
200 0.12
201 0.13
202 0.1
203 0.1
204 0.11
205 0.11
206 0.12
207 0.13
208 0.14