Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NHW6

Protein Details
Accession A0A2T2NHW6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-188NYYTHRSKSMRRKADKVGGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPRYFRTKRNDGEPDPDPEPPMAPPVIILSQTGNGRWHEPRLDAPDPERQPPTSAPINHTAPSARSGSARYNLRNLDKKRPAAADPDPDPPEPDPAPPIIILNKRPARSSPPHTLTPSPTSTPSHSPATPSPDHPMGSKASKISERAQGGKLQPSTAKQDKEEMKEPSNYYTHRSKSMRRKADKVGGAPAQGSGGGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.55
3 0.5
4 0.42
5 0.33
6 0.3
7 0.23
8 0.23
9 0.17
10 0.14
11 0.13
12 0.14
13 0.15
14 0.14
15 0.14
16 0.12
17 0.16
18 0.17
19 0.18
20 0.18
21 0.18
22 0.22
23 0.23
24 0.26
25 0.25
26 0.26
27 0.29
28 0.34
29 0.36
30 0.34
31 0.35
32 0.4
33 0.4
34 0.42
35 0.4
36 0.33
37 0.33
38 0.32
39 0.34
40 0.32
41 0.31
42 0.31
43 0.34
44 0.36
45 0.34
46 0.33
47 0.29
48 0.23
49 0.23
50 0.21
51 0.16
52 0.14
53 0.16
54 0.18
55 0.24
56 0.27
57 0.26
58 0.3
59 0.33
60 0.39
61 0.45
62 0.46
63 0.5
64 0.52
65 0.53
66 0.52
67 0.5
68 0.45
69 0.42
70 0.42
71 0.37
72 0.33
73 0.36
74 0.35
75 0.32
76 0.32
77 0.27
78 0.27
79 0.21
80 0.19
81 0.14
82 0.12
83 0.13
84 0.11
85 0.11
86 0.11
87 0.13
88 0.15
89 0.22
90 0.26
91 0.26
92 0.27
93 0.28
94 0.31
95 0.35
96 0.4
97 0.41
98 0.41
99 0.45
100 0.46
101 0.47
102 0.44
103 0.41
104 0.38
105 0.3
106 0.28
107 0.26
108 0.26
109 0.28
110 0.28
111 0.28
112 0.25
113 0.27
114 0.28
115 0.32
116 0.31
117 0.29
118 0.3
119 0.28
120 0.29
121 0.26
122 0.25
123 0.22
124 0.23
125 0.23
126 0.19
127 0.2
128 0.22
129 0.25
130 0.26
131 0.3
132 0.31
133 0.33
134 0.34
135 0.36
136 0.36
137 0.39
138 0.36
139 0.31
140 0.3
141 0.29
142 0.36
143 0.38
144 0.38
145 0.32
146 0.4
147 0.45
148 0.49
149 0.53
150 0.49
151 0.47
152 0.5
153 0.5
154 0.46
155 0.45
156 0.4
157 0.38
158 0.41
159 0.41
160 0.44
161 0.48
162 0.53
163 0.59
164 0.69
165 0.74
166 0.73
167 0.77
168 0.77
169 0.81
170 0.78
171 0.71
172 0.68
173 0.61
174 0.54
175 0.48
176 0.38
177 0.29
178 0.22