Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NNZ9

Protein Details
Accession A0A2T2NNZ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
158-182WPPTMLPIPKRKRLPKAPGTQGSVAHydrophilic
NLS Segment(s)
PositionSequence
166-173PKRKRLPK
Subcellular Location(s) extr 11, mito 10, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MRASGVRLLMPGVGGAAVWLEGRRASEGRRGGGSRSGRASVPVRAHDVLSHVFSTSPRPATLAPGRASITTAVLLSPSDTCTTHPRLRCQGLGRVIVAAAAAAAAATAAATAAATTAPTTATAATAATGRGEDEHQRTEQTRKKKVSPLHRRILLPFWPPTMLPIPKRKRLPKAPGTQGSVALPNRPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.06
9 0.08
10 0.11
11 0.13
12 0.15
13 0.22
14 0.26
15 0.28
16 0.32
17 0.32
18 0.31
19 0.38
20 0.39
21 0.36
22 0.35
23 0.34
24 0.29
25 0.33
26 0.33
27 0.31
28 0.32
29 0.3
30 0.31
31 0.3
32 0.3
33 0.26
34 0.26
35 0.22
36 0.2
37 0.18
38 0.13
39 0.13
40 0.13
41 0.18
42 0.18
43 0.18
44 0.16
45 0.18
46 0.18
47 0.24
48 0.28
49 0.29
50 0.26
51 0.27
52 0.28
53 0.26
54 0.27
55 0.2
56 0.16
57 0.11
58 0.1
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.09
68 0.14
69 0.2
70 0.25
71 0.28
72 0.32
73 0.37
74 0.39
75 0.4
76 0.38
77 0.38
78 0.37
79 0.35
80 0.3
81 0.24
82 0.21
83 0.17
84 0.14
85 0.08
86 0.04
87 0.02
88 0.02
89 0.02
90 0.01
91 0.01
92 0.01
93 0.01
94 0.01
95 0.01
96 0.01
97 0.01
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.08
119 0.12
120 0.15
121 0.17
122 0.18
123 0.21
124 0.23
125 0.31
126 0.36
127 0.41
128 0.48
129 0.51
130 0.56
131 0.62
132 0.68
133 0.7
134 0.75
135 0.75
136 0.75
137 0.75
138 0.71
139 0.67
140 0.64
141 0.59
142 0.53
143 0.46
144 0.38
145 0.33
146 0.31
147 0.31
148 0.33
149 0.33
150 0.35
151 0.43
152 0.49
153 0.57
154 0.67
155 0.72
156 0.75
157 0.79
158 0.83
159 0.83
160 0.85
161 0.87
162 0.84
163 0.82
164 0.73
165 0.65
166 0.56
167 0.53
168 0.44
169 0.38