Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NL68

Protein Details
Accession A0A2T2NL68    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-78LGNDASRRRRARNSRWQSSWAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAWFWESMVITVDAFHAAKMLGYACKILILVFSICMRIVTVGGVWFVEMVLLSPQGFLGNDASRRRRARNSRWQSSWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.07
5 0.07
6 0.07
7 0.08
8 0.07
9 0.07
10 0.08
11 0.07
12 0.08
13 0.08
14 0.07
15 0.06
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.09
46 0.12
47 0.18
48 0.24
49 0.29
50 0.37
51 0.42
52 0.47
53 0.55
54 0.62
55 0.67
56 0.73
57 0.79
58 0.8