Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7RW63

Protein Details
Accession Q7RW63   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
214-239KSIVRKAYRSRWVRRGRSQERLTRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
KEGG ncr:NCU04357  -  
Amino Acid Sequences MANQSKISFLSLPVELRIRIYRLTWDLDPEPYTFSIILYHNPGSLKHDLLKDQLTQLRKLNSLCRFIRSEALSEFFWQTQVYLRHEPYSNIDGAWYSDEYQQGLDLIIRDPLLAKYTRHVYWAIMLDEDVDDIDRHKHRGIREYTPEFKVPDMPWPWESYYFVMRLPNLTTLHVDVETYKDWRDLRMWSRCMAELYEWPTMKKITLRLTFKTAKSIVRKAYRSRWVRRGRSQERLTRNILNHLLTLPKDTYQDAPCHIIQNHFGYQCPVWRREKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.24
4 0.26
5 0.24
6 0.23
7 0.23
8 0.27
9 0.27
10 0.32
11 0.29
12 0.32
13 0.31
14 0.33
15 0.33
16 0.28
17 0.27
18 0.23
19 0.24
20 0.18
21 0.16
22 0.16
23 0.16
24 0.18
25 0.19
26 0.19
27 0.2
28 0.21
29 0.21
30 0.23
31 0.24
32 0.24
33 0.24
34 0.27
35 0.26
36 0.29
37 0.32
38 0.28
39 0.31
40 0.33
41 0.31
42 0.32
43 0.35
44 0.35
45 0.35
46 0.36
47 0.39
48 0.4
49 0.45
50 0.43
51 0.42
52 0.42
53 0.4
54 0.44
55 0.37
56 0.34
57 0.28
58 0.29
59 0.25
60 0.24
61 0.24
62 0.18
63 0.17
64 0.14
65 0.12
66 0.15
67 0.19
68 0.22
69 0.26
70 0.27
71 0.3
72 0.31
73 0.32
74 0.3
75 0.29
76 0.24
77 0.19
78 0.18
79 0.15
80 0.15
81 0.15
82 0.11
83 0.1
84 0.11
85 0.12
86 0.12
87 0.12
88 0.11
89 0.09
90 0.09
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.09
100 0.1
101 0.1
102 0.12
103 0.16
104 0.17
105 0.18
106 0.18
107 0.16
108 0.18
109 0.2
110 0.18
111 0.13
112 0.13
113 0.11
114 0.11
115 0.1
116 0.07
117 0.04
118 0.04
119 0.04
120 0.09
121 0.09
122 0.11
123 0.13
124 0.16
125 0.18
126 0.26
127 0.3
128 0.32
129 0.39
130 0.43
131 0.45
132 0.45
133 0.45
134 0.37
135 0.33
136 0.3
137 0.23
138 0.25
139 0.23
140 0.23
141 0.22
142 0.24
143 0.25
144 0.22
145 0.23
146 0.17
147 0.17
148 0.15
149 0.15
150 0.15
151 0.13
152 0.14
153 0.14
154 0.16
155 0.15
156 0.15
157 0.15
158 0.14
159 0.15
160 0.14
161 0.13
162 0.09
163 0.11
164 0.11
165 0.11
166 0.11
167 0.14
168 0.14
169 0.16
170 0.17
171 0.21
172 0.28
173 0.35
174 0.36
175 0.35
176 0.37
177 0.36
178 0.35
179 0.3
180 0.24
181 0.2
182 0.22
183 0.26
184 0.25
185 0.24
186 0.24
187 0.24
188 0.23
189 0.22
190 0.24
191 0.26
192 0.34
193 0.39
194 0.4
195 0.47
196 0.52
197 0.5
198 0.51
199 0.45
200 0.44
201 0.46
202 0.5
203 0.51
204 0.54
205 0.59
206 0.59
207 0.65
208 0.68
209 0.7
210 0.72
211 0.74
212 0.76
213 0.8
214 0.82
215 0.84
216 0.83
217 0.84
218 0.84
219 0.82
220 0.8
221 0.77
222 0.72
223 0.68
224 0.62
225 0.59
226 0.54
227 0.46
228 0.39
229 0.34
230 0.32
231 0.26
232 0.28
233 0.22
234 0.2
235 0.21
236 0.21
237 0.26
238 0.26
239 0.29
240 0.28
241 0.31
242 0.31
243 0.35
244 0.34
245 0.32
246 0.33
247 0.36
248 0.38
249 0.34
250 0.34
251 0.32
252 0.32
253 0.36
254 0.38
255 0.39
256 0.43