Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NTK9

Protein Details
Accession A0A2T2NTK9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-104ERTGARRRRGVSRRRRRRRHCDVTGGAWBasic
NLS Segment(s)
PositionSequence
67-95PKVSRMRRGGERTGARRRRGVSRRRRRRR
Subcellular Location(s) mito 10, extr 7, cyto 5, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MDMVTRGLFEQWLRLCWAGWSVLLALYAGPARLSKGIVVRSAEEGDGGVSRRAWVGGTGRICVQLRPKVSRMRRGGERTGARRRRGVSRRRRRRRHCDVTGGAWRGEKAVETRGRVGTGAGQGRRAGGVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.21
5 0.15
6 0.13
7 0.12
8 0.1
9 0.1
10 0.1
11 0.09
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.09
22 0.13
23 0.15
24 0.18
25 0.19
26 0.19
27 0.2
28 0.2
29 0.18
30 0.14
31 0.12
32 0.09
33 0.09
34 0.09
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.13
44 0.13
45 0.14
46 0.14
47 0.17
48 0.17
49 0.17
50 0.2
51 0.2
52 0.22
53 0.25
54 0.29
55 0.35
56 0.39
57 0.47
58 0.47
59 0.48
60 0.52
61 0.54
62 0.54
63 0.53
64 0.55
65 0.54
66 0.6
67 0.61
68 0.56
69 0.56
70 0.55
71 0.57
72 0.6
73 0.63
74 0.64
75 0.68
76 0.77
77 0.83
78 0.91
79 0.92
80 0.93
81 0.94
82 0.93
83 0.9
84 0.88
85 0.81
86 0.78
87 0.75
88 0.67
89 0.57
90 0.47
91 0.39
92 0.3
93 0.26
94 0.2
95 0.13
96 0.19
97 0.23
98 0.26
99 0.3
100 0.31
101 0.31
102 0.3
103 0.28
104 0.24
105 0.26
106 0.3
107 0.27
108 0.28
109 0.27
110 0.28
111 0.27