Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NX44

Protein Details
Accession A0A2T2NX44   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-47GGRPSPRQPKYRHRIPSPTRRLRSRTBasic
NLS Segment(s)
PositionSequence
28-42RQPKYRHRIPSPTRR
157-172ARDKGGRRPESPPGRR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MACGAPPRVHCVPSMTRAETVGGRPSPRQPKYRHRIPSPTRRLRSRTDSVIPSSRRPLRYPSSPLPLVRFTGLRWLAAPATRRHLATADLRLAVPHGPCRPDGLTMLKYQITSSKRPTSLAVLDSPVTMPLVSAYEVFKSPSILAHGRLNPSRRCPARDKGGRRPESPPGRRIRLTLNRATPATSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.36
4 0.36
5 0.37
6 0.33
7 0.3
8 0.3
9 0.27
10 0.27
11 0.29
12 0.37
13 0.45
14 0.49
15 0.55
16 0.56
17 0.65
18 0.72
19 0.79
20 0.79
21 0.77
22 0.81
23 0.82
24 0.85
25 0.85
26 0.86
27 0.84
28 0.82
29 0.79
30 0.75
31 0.74
32 0.69
33 0.65
34 0.6
35 0.57
36 0.54
37 0.57
38 0.52
39 0.48
40 0.5
41 0.49
42 0.46
43 0.44
44 0.46
45 0.44
46 0.49
47 0.53
48 0.5
49 0.5
50 0.5
51 0.49
52 0.46
53 0.41
54 0.35
55 0.29
56 0.24
57 0.17
58 0.22
59 0.22
60 0.18
61 0.17
62 0.17
63 0.16
64 0.18
65 0.21
66 0.14
67 0.19
68 0.21
69 0.2
70 0.2
71 0.2
72 0.2
73 0.2
74 0.21
75 0.17
76 0.16
77 0.16
78 0.15
79 0.15
80 0.14
81 0.11
82 0.11
83 0.12
84 0.12
85 0.13
86 0.16
87 0.16
88 0.15
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.17
95 0.17
96 0.16
97 0.2
98 0.19
99 0.21
100 0.27
101 0.31
102 0.31
103 0.33
104 0.34
105 0.32
106 0.31
107 0.29
108 0.24
109 0.19
110 0.19
111 0.18
112 0.16
113 0.12
114 0.1
115 0.07
116 0.06
117 0.05
118 0.06
119 0.06
120 0.07
121 0.07
122 0.08
123 0.09
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.15
130 0.16
131 0.18
132 0.24
133 0.27
134 0.31
135 0.36
136 0.41
137 0.41
138 0.46
139 0.53
140 0.51
141 0.54
142 0.55
143 0.59
144 0.63
145 0.69
146 0.71
147 0.72
148 0.79
149 0.79
150 0.75
151 0.72
152 0.72
153 0.73
154 0.7
155 0.68
156 0.67
157 0.68
158 0.66
159 0.64
160 0.64
161 0.63
162 0.64
163 0.65
164 0.63
165 0.6
166 0.59