Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NWE5

Protein Details
Accession A0A2T2NWE5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
71-99IAERLRRKRVEYSRKKKQVQSPQARQYMHHydrophilic
NLS Segment(s)
PositionSequence
74-87RLRRKRVEYSRKKK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNIRLLTSHFHPTAPVGLISFEDHAQCNKKHAFEEVSHYLHPFTLSVQATILKYVPCIQASCSTVKHMTRIAERLRRKRVEYSRKKKQVQSPQARQYMHGYNSFILANALPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.13
4 0.13
5 0.14
6 0.14
7 0.14
8 0.12
9 0.11
10 0.12
11 0.16
12 0.2
13 0.2
14 0.25
15 0.26
16 0.28
17 0.27
18 0.3
19 0.3
20 0.27
21 0.34
22 0.33
23 0.33
24 0.31
25 0.3
26 0.27
27 0.23
28 0.21
29 0.14
30 0.09
31 0.12
32 0.12
33 0.12
34 0.12
35 0.14
36 0.13
37 0.14
38 0.14
39 0.08
40 0.08
41 0.1
42 0.11
43 0.1
44 0.1
45 0.11
46 0.14
47 0.16
48 0.18
49 0.16
50 0.17
51 0.2
52 0.2
53 0.21
54 0.2
55 0.21
56 0.22
57 0.27
58 0.32
59 0.37
60 0.46
61 0.53
62 0.6
63 0.61
64 0.62
65 0.66
66 0.7
67 0.72
68 0.75
69 0.76
70 0.79
71 0.84
72 0.87
73 0.85
74 0.84
75 0.84
76 0.84
77 0.85
78 0.84
79 0.83
80 0.84
81 0.76
82 0.69
83 0.63
84 0.59
85 0.52
86 0.45
87 0.38
88 0.31
89 0.32
90 0.3
91 0.24
92 0.18
93 0.14