Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2MZL3

Protein Details
Accession A0A2T2MZL3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
179-201NDIKASKHLKRLNKKLREKSEGGBasic
NLS Segment(s)
PositionSequence
188-193KRLNKK
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036465  vWFA_dom_sf  
Amino Acid Sequences RDPPPPYSFHDVNSPSNPIGENIVSTDGSKYAFLQQFDMYIVIDNSDSMQGPLWEEAKEVLREIVSIHTTYNPYDLEIRFLNHDATYRVSSVSEVEKFLSLVKPNGRTYIAKSVYSISLPYFDMCMGNLGDIKPINIVIITGSKATDDVQEAIVDSAQDIRRYNAPSYQFGLHCFQVGNDIKASKHLKRLNKKLREKSEGGSEMGIIVNIVPSTEENKLLHAKTVLEVVIDSFDKRLEMSNPPEEIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.36
3 0.36
4 0.34
5 0.26
6 0.25
7 0.2
8 0.17
9 0.14
10 0.16
11 0.15
12 0.15
13 0.15
14 0.12
15 0.13
16 0.13
17 0.12
18 0.19
19 0.22
20 0.22
21 0.24
22 0.23
23 0.23
24 0.24
25 0.23
26 0.14
27 0.12
28 0.11
29 0.09
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.07
36 0.08
37 0.08
38 0.09
39 0.11
40 0.12
41 0.1
42 0.11
43 0.12
44 0.15
45 0.15
46 0.14
47 0.13
48 0.12
49 0.12
50 0.12
51 0.13
52 0.11
53 0.11
54 0.11
55 0.13
56 0.14
57 0.15
58 0.16
59 0.13
60 0.13
61 0.16
62 0.16
63 0.16
64 0.16
65 0.17
66 0.17
67 0.18
68 0.18
69 0.14
70 0.15
71 0.13
72 0.15
73 0.15
74 0.14
75 0.13
76 0.12
77 0.12
78 0.12
79 0.15
80 0.13
81 0.12
82 0.12
83 0.12
84 0.12
85 0.13
86 0.14
87 0.12
88 0.14
89 0.17
90 0.21
91 0.22
92 0.24
93 0.25
94 0.23
95 0.26
96 0.32
97 0.31
98 0.26
99 0.26
100 0.25
101 0.24
102 0.23
103 0.2
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.06
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.05
124 0.05
125 0.04
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.06
142 0.05
143 0.09
144 0.1
145 0.12
146 0.12
147 0.14
148 0.18
149 0.21
150 0.22
151 0.23
152 0.25
153 0.26
154 0.28
155 0.3
156 0.27
157 0.27
158 0.29
159 0.24
160 0.21
161 0.19
162 0.15
163 0.2
164 0.22
165 0.2
166 0.19
167 0.2
168 0.19
169 0.26
170 0.32
171 0.26
172 0.34
173 0.39
174 0.48
175 0.57
176 0.68
177 0.72
178 0.77
179 0.85
180 0.86
181 0.88
182 0.86
183 0.79
184 0.71
185 0.7
186 0.62
187 0.53
188 0.42
189 0.33
190 0.26
191 0.22
192 0.19
193 0.09
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.09
201 0.11
202 0.15
203 0.14
204 0.19
205 0.24
206 0.24
207 0.26
208 0.24
209 0.24
210 0.21
211 0.24
212 0.2
213 0.15
214 0.14
215 0.12
216 0.13
217 0.13
218 0.13
219 0.11
220 0.11
221 0.11
222 0.12
223 0.15
224 0.15
225 0.22
226 0.28
227 0.34
228 0.35