Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NUA9

Protein Details
Accession A0A2T2NUA9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-92AARTRVPCCCRCRCRCRYRRRRRRRRRSTSPIFRGAAHydrophilic
NLS Segment(s)
PositionSequence
74-83RRRRRRRRRS
Subcellular Location(s) extr 17, mito 5, nucl 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences GCHSRPCSAGLLIGGALNCSSSVWRHARPVSRPTAPRLLPWNRRPLPVAMQPCGHAARTRVPCCCRCRCRCRYRRRRRRRRRSTSPIFRGAASHVSGPPSPVPRPTSHAPAPHALAGSAGPAGPAGPAASQGNAPGVELRCSLGIADPASRANHTRFGWPAHMYASGTTNTHGLAAWGIPQANGAEQASPLYPRLDPHASIWPVLVRGFVFFFCSQRARAGSLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.1
4 0.08
5 0.07
6 0.07
7 0.08
8 0.08
9 0.15
10 0.21
11 0.24
12 0.31
13 0.37
14 0.45
15 0.5
16 0.56
17 0.57
18 0.59
19 0.6
20 0.59
21 0.62
22 0.55
23 0.53
24 0.55
25 0.57
26 0.59
27 0.62
28 0.67
29 0.6
30 0.62
31 0.6
32 0.55
33 0.52
34 0.5
35 0.49
36 0.41
37 0.39
38 0.37
39 0.37
40 0.35
41 0.28
42 0.22
43 0.19
44 0.25
45 0.33
46 0.35
47 0.39
48 0.44
49 0.5
50 0.56
51 0.64
52 0.65
53 0.66
54 0.73
55 0.77
56 0.83
57 0.85
58 0.89
59 0.9
60 0.92
61 0.94
62 0.95
63 0.96
64 0.96
65 0.97
66 0.97
67 0.97
68 0.96
69 0.96
70 0.95
71 0.95
72 0.9
73 0.86
74 0.75
75 0.65
76 0.54
77 0.45
78 0.37
79 0.26
80 0.2
81 0.14
82 0.14
83 0.14
84 0.14
85 0.15
86 0.15
87 0.15
88 0.17
89 0.2
90 0.19
91 0.25
92 0.26
93 0.3
94 0.3
95 0.33
96 0.32
97 0.3
98 0.3
99 0.25
100 0.23
101 0.16
102 0.13
103 0.1
104 0.08
105 0.06
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.05
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.09
124 0.09
125 0.1
126 0.1
127 0.09
128 0.09
129 0.09
130 0.07
131 0.08
132 0.08
133 0.08
134 0.09
135 0.1
136 0.11
137 0.12
138 0.14
139 0.15
140 0.21
141 0.21
142 0.24
143 0.24
144 0.27
145 0.3
146 0.29
147 0.27
148 0.22
149 0.23
150 0.19
151 0.18
152 0.17
153 0.14
154 0.13
155 0.13
156 0.12
157 0.1
158 0.1
159 0.09
160 0.07
161 0.07
162 0.06
163 0.07
164 0.08
165 0.08
166 0.08
167 0.09
168 0.09
169 0.09
170 0.11
171 0.09
172 0.08
173 0.09
174 0.1
175 0.1
176 0.11
177 0.12
178 0.12
179 0.12
180 0.13
181 0.19
182 0.22
183 0.22
184 0.24
185 0.33
186 0.32
187 0.32
188 0.32
189 0.27
190 0.25
191 0.23
192 0.21
193 0.12
194 0.13
195 0.14
196 0.13
197 0.16
198 0.16
199 0.18
200 0.21
201 0.23
202 0.23
203 0.27
204 0.29