Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2PBD9

Protein Details
Accession A0A2T2PBD9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-30QSLLRCRKRSSSKAPVKCRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MCWPHRFHPQSLLRCRKRSSSKAPVKCRVGVTIMSLGAPLLISLPSGACRADGERAEQALGRLGVWLATMSVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.74
4 0.74
5 0.73
6 0.72
7 0.72
8 0.75
9 0.78
10 0.84
11 0.83
12 0.78
13 0.72
14 0.64
15 0.54
16 0.46
17 0.37
18 0.29
19 0.22
20 0.18
21 0.14
22 0.12
23 0.1
24 0.08
25 0.07
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.13
39 0.13
40 0.16
41 0.18
42 0.18
43 0.19
44 0.19
45 0.18
46 0.17
47 0.17
48 0.13
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09