Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NMZ0

Protein Details
Accession A0A2T2NMZ0   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-64ASPCCRGCCKPPCRRRRRLCRSSYIAEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 9, nucl 4, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MLSCARLILPWISLLWARCILPDLSRDSRSHRDGSPTASPCCRGCCKPPCRRRRRLCRSSYIAEGTEGYQQQPHVTLRPVVGRCSRGHGMLGQPCRRARIAVMIRNGELAPKAAPNYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.16
5 0.15
6 0.18
7 0.17
8 0.17
9 0.19
10 0.23
11 0.26
12 0.29
13 0.3
14 0.34
15 0.41
16 0.42
17 0.43
18 0.37
19 0.39
20 0.37
21 0.42
22 0.43
23 0.4
24 0.39
25 0.37
26 0.37
27 0.31
28 0.35
29 0.34
30 0.28
31 0.33
32 0.41
33 0.49
34 0.57
35 0.66
36 0.72
37 0.78
38 0.86
39 0.88
40 0.89
41 0.91
42 0.9
43 0.87
44 0.84
45 0.8
46 0.72
47 0.65
48 0.56
49 0.45
50 0.35
51 0.29
52 0.21
53 0.18
54 0.15
55 0.12
56 0.11
57 0.1
58 0.1
59 0.12
60 0.12
61 0.12
62 0.13
63 0.14
64 0.15
65 0.22
66 0.22
67 0.24
68 0.27
69 0.28
70 0.27
71 0.33
72 0.32
73 0.26
74 0.27
75 0.25
76 0.27
77 0.31
78 0.39
79 0.36
80 0.4
81 0.41
82 0.43
83 0.42
84 0.36
85 0.31
86 0.34
87 0.38
88 0.39
89 0.45
90 0.44
91 0.44
92 0.44
93 0.42
94 0.33
95 0.25
96 0.2
97 0.15
98 0.15