Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NM28

Protein Details
Accession A0A2T2NM28   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
142-166KKYGPGRRKMSDKGRRKAKDDSKAVBasic
NLS Segment(s)
PositionSequence
136-160KKADRDKKYGPGRRKMSDKGRRKAK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003165  Piwi  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF02171  Piwi  
Amino Acid Sequences MSQGACGFQRALSSQYGKGSTLPGTFVDKLVASPYYRGFYLQLHIGVKGTVRPAHYFVLENDTTHLSLGDLRDLTHSLNYPYVRSLVGVSYTSPTYYADRLCERGRLYLQKFFVTNVDEDLYKDVNNFKNEQSDLKKADRDKKYGPGRRKMSDKGRRKAKDDSKAVTLAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.29
4 0.27
5 0.26
6 0.26
7 0.24
8 0.21
9 0.2
10 0.17
11 0.21
12 0.21
13 0.2
14 0.19
15 0.16
16 0.16
17 0.17
18 0.17
19 0.12
20 0.14
21 0.16
22 0.16
23 0.16
24 0.17
25 0.16
26 0.15
27 0.17
28 0.17
29 0.18
30 0.17
31 0.17
32 0.17
33 0.15
34 0.14
35 0.14
36 0.14
37 0.13
38 0.14
39 0.16
40 0.18
41 0.19
42 0.2
43 0.2
44 0.18
45 0.22
46 0.2
47 0.19
48 0.18
49 0.17
50 0.16
51 0.15
52 0.14
53 0.07
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.09
63 0.1
64 0.09
65 0.12
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.1
73 0.07
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.11
85 0.12
86 0.14
87 0.18
88 0.18
89 0.21
90 0.2
91 0.22
92 0.25
93 0.3
94 0.32
95 0.34
96 0.34
97 0.33
98 0.32
99 0.3
100 0.28
101 0.22
102 0.19
103 0.15
104 0.15
105 0.13
106 0.13
107 0.15
108 0.13
109 0.11
110 0.12
111 0.16
112 0.2
113 0.23
114 0.24
115 0.23
116 0.28
117 0.29
118 0.35
119 0.35
120 0.36
121 0.38
122 0.4
123 0.45
124 0.46
125 0.55
126 0.55
127 0.56
128 0.54
129 0.6
130 0.66
131 0.7
132 0.72
133 0.73
134 0.74
135 0.75
136 0.77
137 0.76
138 0.77
139 0.78
140 0.79
141 0.79
142 0.83
143 0.82
144 0.8
145 0.81
146 0.8
147 0.8
148 0.78
149 0.73
150 0.68