Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NPG5

Protein Details
Accession A0A2T2NPG5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
50-71VETQTHILRKTKKKTPHPKKAPBasic
NLS Segment(s)
PositionSequence
58-71RKTKKKTPHPKKAP
Subcellular Location(s) mito 14, extr 6, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKFFHFQKPGAVMLFFCFSAPNSNCFATNSLTNKRPNAKAGGGGKPPLTVETQTHILRKTKKKTPHPKKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.13
4 0.11
5 0.1
6 0.18
7 0.19
8 0.2
9 0.21
10 0.22
11 0.22
12 0.23
13 0.24
14 0.18
15 0.21
16 0.23
17 0.25
18 0.29
19 0.31
20 0.34
21 0.37
22 0.37
23 0.34
24 0.33
25 0.29
26 0.3
27 0.32
28 0.34
29 0.31
30 0.31
31 0.28
32 0.25
33 0.24
34 0.2
35 0.17
36 0.13
37 0.13
38 0.16
39 0.21
40 0.23
41 0.25
42 0.28
43 0.33
44 0.41
45 0.49
46 0.54
47 0.57
48 0.66
49 0.74
50 0.82
51 0.87