Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NC97

Protein Details
Accession A0A2T2NC97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27QPYPIRARSCLRRRARARVCVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, extr 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIVCTQPYPIRARSCLRRRARARVCVCVCVCVCVCVCVCVCVCVSIRAAMTKGTICWAYTLYQSKLSMSVSDLLGGETQSKISTVMYPSGTVVFGGEEMVQLDGAKGLDRPWNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.69
4 0.73
5 0.75
6 0.8
7 0.81
8 0.81
9 0.77
10 0.77
11 0.71
12 0.68
13 0.62
14 0.56
15 0.47
16 0.4
17 0.35
18 0.27
19 0.24
20 0.19
21 0.18
22 0.15
23 0.15
24 0.14
25 0.14
26 0.13
27 0.12
28 0.13
29 0.13
30 0.13
31 0.13
32 0.12
33 0.13
34 0.12
35 0.12
36 0.1
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.11
47 0.15
48 0.15
49 0.17
50 0.17
51 0.17
52 0.17
53 0.17
54 0.14
55 0.11
56 0.12
57 0.09
58 0.1
59 0.1
60 0.09
61 0.09
62 0.08
63 0.08
64 0.06
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.09
71 0.1
72 0.13
73 0.13
74 0.14
75 0.14
76 0.15
77 0.14
78 0.12
79 0.1
80 0.07
81 0.06
82 0.07
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.09