Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2N279

Protein Details
Accession A0A2T2N279    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-70DSAPKSTKSKHEKKSSHDYKTHBasic
374-395NVLSRNPTEKRKSWFKRRFSKDHydrophilic
NLS Segment(s)
PositionSequence
389-389K
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MDRSQQRQQHPFHSYSQNHPSQSQVPSQPGSQRPRSKSAFSFKSDKSHDSAPKSTKSKHEKKSSHDYKTHYDPTTKANPNAAMNEAQPIAAALEKPTLQSLRSFQHTDANGNPIAEPDLSNPTRSRWERPLDTIRSFEAAIDTEYRRRARPMGPESTVSGFASRRSSYYGGGYDQNRFSQASGYYNGRQGARDSWADNGYGNGYGNGYGGNGYSNGYGNGNGNGNGMGMGMGGPVGPPRTRYNRMQSDPQYNRSSNGNNVYPVQGYQQSRDTVNSNGSNGSHSEPYSNDLGSENSSIERGAPVRQPDMGEQYGFSGFGRDPILEEYGSNGEGGNGYFPVQPTNAAVPPPVPVKTTTAPIALNSPPAANGNNRPNVLSRNPTEKRKSWFKRRFSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.66
4 0.63
5 0.59
6 0.56
7 0.54
8 0.5
9 0.5
10 0.49
11 0.44
12 0.43
13 0.42
14 0.45
15 0.48
16 0.51
17 0.55
18 0.57
19 0.61
20 0.62
21 0.69
22 0.7
23 0.69
24 0.68
25 0.7
26 0.68
27 0.64
28 0.66
29 0.6
30 0.64
31 0.62
32 0.57
33 0.51
34 0.52
35 0.54
36 0.53
37 0.58
38 0.55
39 0.59
40 0.62
41 0.63
42 0.64
43 0.68
44 0.71
45 0.73
46 0.78
47 0.76
48 0.78
49 0.84
50 0.84
51 0.82
52 0.78
53 0.74
54 0.7
55 0.72
56 0.72
57 0.63
58 0.57
59 0.49
60 0.5
61 0.55
62 0.53
63 0.47
64 0.44
65 0.44
66 0.43
67 0.43
68 0.39
69 0.3
70 0.25
71 0.25
72 0.2
73 0.16
74 0.13
75 0.11
76 0.09
77 0.09
78 0.09
79 0.07
80 0.09
81 0.09
82 0.1
83 0.12
84 0.13
85 0.13
86 0.15
87 0.19
88 0.2
89 0.25
90 0.27
91 0.25
92 0.31
93 0.32
94 0.32
95 0.3
96 0.3
97 0.26
98 0.24
99 0.23
100 0.16
101 0.16
102 0.14
103 0.12
104 0.1
105 0.18
106 0.18
107 0.2
108 0.2
109 0.21
110 0.3
111 0.32
112 0.36
113 0.36
114 0.43
115 0.44
116 0.51
117 0.57
118 0.55
119 0.54
120 0.5
121 0.43
122 0.37
123 0.33
124 0.26
125 0.18
126 0.12
127 0.11
128 0.13
129 0.13
130 0.15
131 0.2
132 0.22
133 0.22
134 0.24
135 0.27
136 0.28
137 0.37
138 0.4
139 0.42
140 0.42
141 0.42
142 0.42
143 0.39
144 0.36
145 0.26
146 0.21
147 0.15
148 0.14
149 0.17
150 0.15
151 0.14
152 0.16
153 0.17
154 0.17
155 0.19
156 0.18
157 0.16
158 0.21
159 0.21
160 0.21
161 0.21
162 0.21
163 0.19
164 0.18
165 0.16
166 0.14
167 0.14
168 0.13
169 0.14
170 0.17
171 0.17
172 0.2
173 0.21
174 0.19
175 0.19
176 0.18
177 0.17
178 0.17
179 0.17
180 0.15
181 0.15
182 0.15
183 0.15
184 0.13
185 0.12
186 0.09
187 0.09
188 0.08
189 0.06
190 0.05
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.07
205 0.07
206 0.08
207 0.09
208 0.08
209 0.08
210 0.08
211 0.07
212 0.07
213 0.06
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.02
220 0.02
221 0.03
222 0.05
223 0.05
224 0.08
225 0.13
226 0.21
227 0.26
228 0.32
229 0.41
230 0.49
231 0.53
232 0.59
233 0.59
234 0.63
235 0.62
236 0.63
237 0.59
238 0.51
239 0.49
240 0.44
241 0.41
242 0.35
243 0.36
244 0.31
245 0.26
246 0.27
247 0.27
248 0.23
249 0.21
250 0.19
251 0.2
252 0.19
253 0.2
254 0.23
255 0.23
256 0.24
257 0.25
258 0.25
259 0.21
260 0.25
261 0.24
262 0.21
263 0.21
264 0.2
265 0.19
266 0.19
267 0.19
268 0.15
269 0.14
270 0.15
271 0.14
272 0.17
273 0.17
274 0.16
275 0.13
276 0.12
277 0.13
278 0.14
279 0.14
280 0.12
281 0.1
282 0.11
283 0.1
284 0.1
285 0.11
286 0.1
287 0.12
288 0.16
289 0.19
290 0.2
291 0.22
292 0.23
293 0.23
294 0.28
295 0.26
296 0.22
297 0.2
298 0.2
299 0.19
300 0.17
301 0.15
302 0.11
303 0.09
304 0.12
305 0.13
306 0.11
307 0.12
308 0.14
309 0.16
310 0.14
311 0.14
312 0.14
313 0.14
314 0.14
315 0.13
316 0.11
317 0.09
318 0.09
319 0.1
320 0.08
321 0.07
322 0.08
323 0.1
324 0.1
325 0.12
326 0.12
327 0.13
328 0.15
329 0.19
330 0.19
331 0.18
332 0.19
333 0.17
334 0.2
335 0.22
336 0.21
337 0.18
338 0.18
339 0.23
340 0.25
341 0.29
342 0.28
343 0.27
344 0.27
345 0.26
346 0.29
347 0.24
348 0.24
349 0.21
350 0.19
351 0.17
352 0.19
353 0.2
354 0.21
355 0.28
356 0.34
357 0.4
358 0.4
359 0.41
360 0.42
361 0.46
362 0.48
363 0.47
364 0.44
365 0.48
366 0.54
367 0.62
368 0.67
369 0.67
370 0.7
371 0.73
372 0.79
373 0.79
374 0.83
375 0.84