Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NW03

Protein Details
Accession A0A2T2NW03    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-157LTAHPAHPLRRLRRRPKRSRRLCKTTHLAAHydrophilic
176-200ATVAPNYCRRRPRSRYVSPFTIRRMHydrophilic
NLS Segment(s)
PositionSequence
135-148PLRRLRRRPKRSRR
Subcellular Location(s) mito 19, cyto 4, nucl 2
Family & Domain DBs
Amino Acid Sequences MGIGSWVRWSTSLLGVSKKGRTKYGGEFWQAKKEVWGVFDKRLSVGQGARRALYLLPRRRLGAVVVETDASSTDTRPPPEPVRWLLYGTGAGLPSRLCSAAVVDSSRLVSSPLRSWASNLHVLLAAPLTAHPAHPLRRLRRRPKRSRRLCKTTHLAAYFKHHTAIITPFTSLACRATVAPNYCRRRPRSRYVSPFTIRRMQLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.34
4 0.39
5 0.43
6 0.41
7 0.41
8 0.42
9 0.44
10 0.48
11 0.53
12 0.53
13 0.53
14 0.58
15 0.56
16 0.61
17 0.57
18 0.49
19 0.42
20 0.39
21 0.35
22 0.29
23 0.34
24 0.28
25 0.32
26 0.34
27 0.32
28 0.29
29 0.29
30 0.28
31 0.23
32 0.24
33 0.25
34 0.3
35 0.3
36 0.29
37 0.28
38 0.27
39 0.25
40 0.29
41 0.33
42 0.35
43 0.39
44 0.4
45 0.41
46 0.41
47 0.41
48 0.33
49 0.3
50 0.24
51 0.2
52 0.18
53 0.17
54 0.16
55 0.15
56 0.14
57 0.1
58 0.08
59 0.07
60 0.13
61 0.15
62 0.18
63 0.19
64 0.24
65 0.26
66 0.29
67 0.32
68 0.3
69 0.31
70 0.3
71 0.29
72 0.25
73 0.21
74 0.18
75 0.15
76 0.13
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.07
96 0.07
97 0.08
98 0.1
99 0.14
100 0.16
101 0.16
102 0.17
103 0.19
104 0.22
105 0.24
106 0.22
107 0.18
108 0.16
109 0.16
110 0.16
111 0.12
112 0.08
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.09
119 0.12
120 0.16
121 0.23
122 0.31
123 0.38
124 0.49
125 0.6
126 0.68
127 0.76
128 0.84
129 0.88
130 0.92
131 0.94
132 0.95
133 0.96
134 0.95
135 0.93
136 0.88
137 0.86
138 0.82
139 0.78
140 0.74
141 0.66
142 0.57
143 0.49
144 0.51
145 0.47
146 0.4
147 0.34
148 0.26
149 0.23
150 0.24
151 0.26
152 0.22
153 0.19
154 0.18
155 0.18
156 0.18
157 0.18
158 0.16
159 0.14
160 0.1
161 0.1
162 0.12
163 0.16
164 0.22
165 0.26
166 0.33
167 0.41
168 0.48
169 0.55
170 0.62
171 0.65
172 0.69
173 0.73
174 0.76
175 0.77
176 0.81
177 0.84
178 0.83
179 0.86
180 0.82
181 0.8
182 0.76
183 0.74