Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7RX98

Protein Details
Accession Q7RX98    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-131HNGAHILHQRHKRRKNPGRLYVGGRBasic
NLS Segment(s)
PositionSequence
116-124RHKRRKNPG
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
KEGG ncr:NCU00189  -  
Amino Acid Sequences MWRVSLQVAQKAKHPSSNPMNKLWGSWYSQTRIPRAITITLAWYLAEHALTQNSCALFCWRTRLILLILGGPDRQFQPNIKLPTLRTHNFSTASAAVLLVPVGLAGHNGAHILHQRHKRRKNPGRLYVGGRTRRLWGASEAVVMLANLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.53
4 0.62
5 0.6
6 0.56
7 0.58
8 0.51
9 0.5
10 0.44
11 0.37
12 0.31
13 0.33
14 0.33
15 0.31
16 0.35
17 0.38
18 0.38
19 0.39
20 0.36
21 0.33
22 0.31
23 0.3
24 0.26
25 0.23
26 0.22
27 0.18
28 0.16
29 0.13
30 0.1
31 0.09
32 0.09
33 0.08
34 0.06
35 0.06
36 0.08
37 0.08
38 0.09
39 0.1
40 0.1
41 0.09
42 0.1
43 0.12
44 0.11
45 0.12
46 0.17
47 0.15
48 0.16
49 0.16
50 0.17
51 0.15
52 0.16
53 0.16
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.09
64 0.15
65 0.22
66 0.25
67 0.25
68 0.26
69 0.26
70 0.32
71 0.38
72 0.34
73 0.31
74 0.3
75 0.32
76 0.32
77 0.31
78 0.27
79 0.2
80 0.19
81 0.15
82 0.12
83 0.09
84 0.08
85 0.07
86 0.04
87 0.03
88 0.02
89 0.02
90 0.02
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.06
98 0.11
99 0.15
100 0.22
101 0.32
102 0.42
103 0.53
104 0.62
105 0.7
106 0.77
107 0.83
108 0.87
109 0.88
110 0.88
111 0.86
112 0.82
113 0.79
114 0.77
115 0.75
116 0.71
117 0.64
118 0.55
119 0.5
120 0.49
121 0.44
122 0.38
123 0.32
124 0.29
125 0.27
126 0.26
127 0.23
128 0.19
129 0.18
130 0.15