Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2N3L3

Protein Details
Accession A0A2T2N3L3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRMSRHQKYRQRERLRHVDSVHydrophilic
77-103KYTVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-94VKRYRKGIHK
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSGGLLWKIPWRMSRHQKYRQRERLRHVDSVVATLDSALGRVGQSTKKVERWKVEMPTEAEMLPKDKYTVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.88
17 0.89
18 0.89
19 0.86
20 0.84
21 0.85
22 0.81
23 0.74
24 0.63
25 0.57
26 0.46
27 0.4
28 0.32
29 0.21
30 0.15
31 0.11
32 0.11
33 0.06
34 0.06
35 0.04
36 0.04
37 0.04
38 0.04
39 0.06
40 0.07
41 0.09
42 0.13
43 0.16
44 0.21
45 0.27
46 0.31
47 0.33
48 0.38
49 0.42
50 0.43
51 0.43
52 0.41
53 0.38
54 0.36
55 0.33
56 0.27
57 0.22
58 0.17
59 0.16
60 0.13
61 0.11
62 0.1
63 0.1
64 0.13
65 0.18
66 0.27
67 0.3
68 0.38
69 0.44
70 0.54
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79