Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NZY9

Protein Details
Accession A0A2T2NZY9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
118-144TDPLLERLTKKKKYRTGKSSARDERVLHydrophilic
NLS Segment(s)
PositionSequence
128-130KKK
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences IIFLNAFPDVRKWNTAGILAGMLPKDTIRFIDENLLVDLAGAIDPGHGVNHNEMYKEIMNVTFTALEKQMASTPGLTIITSGCLLNTPEDITLLLSYIERSRLKNIKFYLVSLTMRETDPLLERLTKKKKYRTGKSSARDERVLEKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.25
4 0.2
5 0.18
6 0.15
7 0.16
8 0.12
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.12
16 0.12
17 0.13
18 0.2
19 0.2
20 0.21
21 0.21
22 0.2
23 0.15
24 0.14
25 0.13
26 0.07
27 0.06
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.05
35 0.06
36 0.07
37 0.12
38 0.12
39 0.13
40 0.13
41 0.16
42 0.15
43 0.15
44 0.14
45 0.1
46 0.1
47 0.1
48 0.1
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.05
83 0.06
84 0.06
85 0.12
86 0.13
87 0.14
88 0.22
89 0.29
90 0.3
91 0.37
92 0.38
93 0.41
94 0.4
95 0.39
96 0.37
97 0.34
98 0.34
99 0.28
100 0.28
101 0.21
102 0.21
103 0.2
104 0.16
105 0.14
106 0.16
107 0.16
108 0.16
109 0.2
110 0.23
111 0.33
112 0.42
113 0.49
114 0.55
115 0.63
116 0.71
117 0.76
118 0.84
119 0.83
120 0.84
121 0.85
122 0.85
123 0.87
124 0.86
125 0.82
126 0.74
127 0.68
128 0.63