Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SCW2

Protein Details
Accession Q7SCW2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAPTKPKNKSQKDKAKARARGAAQHydrophilic
NLS Segment(s)
PositionSequence
5-20KPKNKSQKDKAKARAR
Subcellular Location(s) mito 10.5, cyto_mito 8.833, nucl 7.5, cyto_nucl 7.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0051301  P:cell division  
GO:0045842  P:positive regulation of mitotic metaphase/anaphase transition  
GO:0016567  P:protein ubiquitination  
KEGG ncr:NCU09382  -  
Pfam View protein in Pfam  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MAPTKPKNKSQKDKAKARARGAAQPSNVNARELLNNASAMLEVGDIESAAKTAKSAYKAIGEDGKLAGAALSLLGHIYVELGEIEAAREFFFAAVKTDEDGTLPEDVAGGPEKFLWLAQLSEEGGQDSVSWYDRGASALRLQIQTLSDELEKRPHGKEQQEALITEKKRRLAAILCAVAEVYMTDLSWEEDAEQRCEALITEAIMLAPELADTWQTVANVRISQTRVDEAKEALRRSMALWELLEPEDPSVPQFPTRVSLVRLLIEVGMEEKAIDVAERLIIEDDQAVEVWYLSGYGRYLLGEKIKSGELQAPEGETWQDIWRLSRKYLAQCLRTYAAIEYEDERLGAHAQELLDSIRGELGVVGAEEDEVWEDTDVEEDEDEEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.9
4 0.86
5 0.83
6 0.76
7 0.75
8 0.73
9 0.69
10 0.62
11 0.58
12 0.54
13 0.54
14 0.5
15 0.42
16 0.35
17 0.3
18 0.3
19 0.27
20 0.28
21 0.21
22 0.2
23 0.19
24 0.18
25 0.15
26 0.12
27 0.1
28 0.07
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.09
40 0.14
41 0.17
42 0.19
43 0.21
44 0.26
45 0.27
46 0.3
47 0.32
48 0.28
49 0.26
50 0.25
51 0.22
52 0.16
53 0.15
54 0.12
55 0.06
56 0.06
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.09
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.08
95 0.1
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.06
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.1
110 0.09
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.08
121 0.09
122 0.1
123 0.1
124 0.11
125 0.13
126 0.17
127 0.16
128 0.16
129 0.16
130 0.15
131 0.15
132 0.13
133 0.12
134 0.1
135 0.11
136 0.12
137 0.16
138 0.16
139 0.19
140 0.2
141 0.24
142 0.29
143 0.31
144 0.36
145 0.35
146 0.38
147 0.37
148 0.36
149 0.34
150 0.34
151 0.32
152 0.31
153 0.31
154 0.28
155 0.27
156 0.27
157 0.26
158 0.23
159 0.27
160 0.28
161 0.26
162 0.24
163 0.23
164 0.22
165 0.19
166 0.16
167 0.1
168 0.05
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.09
178 0.1
179 0.11
180 0.11
181 0.1
182 0.1
183 0.1
184 0.1
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.03
199 0.03
200 0.04
201 0.05
202 0.06
203 0.06
204 0.08
205 0.09
206 0.1
207 0.11
208 0.13
209 0.13
210 0.15
211 0.15
212 0.17
213 0.16
214 0.17
215 0.17
216 0.15
217 0.2
218 0.24
219 0.23
220 0.2
221 0.2
222 0.19
223 0.18
224 0.21
225 0.15
226 0.12
227 0.12
228 0.12
229 0.14
230 0.14
231 0.13
232 0.1
233 0.1
234 0.09
235 0.09
236 0.09
237 0.09
238 0.1
239 0.1
240 0.11
241 0.11
242 0.13
243 0.15
244 0.16
245 0.16
246 0.19
247 0.19
248 0.19
249 0.19
250 0.16
251 0.14
252 0.12
253 0.1
254 0.07
255 0.06
256 0.05
257 0.05
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.05
265 0.05
266 0.06
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.07
275 0.06
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.06
285 0.07
286 0.08
287 0.1
288 0.15
289 0.15
290 0.16
291 0.17
292 0.18
293 0.18
294 0.18
295 0.21
296 0.18
297 0.2
298 0.2
299 0.19
300 0.18
301 0.19
302 0.18
303 0.12
304 0.13
305 0.12
306 0.14
307 0.13
308 0.17
309 0.24
310 0.27
311 0.27
312 0.32
313 0.36
314 0.41
315 0.5
316 0.54
317 0.53
318 0.51
319 0.56
320 0.51
321 0.46
322 0.4
323 0.31
324 0.27
325 0.22
326 0.21
327 0.18
328 0.18
329 0.18
330 0.16
331 0.15
332 0.13
333 0.13
334 0.12
335 0.1
336 0.1
337 0.1
338 0.11
339 0.12
340 0.11
341 0.12
342 0.12
343 0.12
344 0.1
345 0.1
346 0.09
347 0.08
348 0.08
349 0.06
350 0.06
351 0.06
352 0.05
353 0.05
354 0.05
355 0.06
356 0.07
357 0.07
358 0.08
359 0.08
360 0.08
361 0.08
362 0.1
363 0.11
364 0.1
365 0.09
366 0.09