Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P678

Protein Details
Accession A0A2T2P678    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-60RSIIRSMTPNPRKKKRERSPEKGEQVCHydrophilic
NLS Segment(s)
PositionSequence
44-53PRKKKRERSP
Subcellular Location(s) mito 15.5, mito_nucl 12.166, nucl 7.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MLSPPLVIPANCLQLPQAIILAPCLSMARPVPLRSIIRSMTPNPRKKKRERSPEKGEQVCVLHVCVRSCMRGELKGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.17
4 0.14
5 0.09
6 0.09
7 0.1
8 0.1
9 0.08
10 0.07
11 0.07
12 0.06
13 0.07
14 0.08
15 0.11
16 0.13
17 0.14
18 0.16
19 0.2
20 0.22
21 0.21
22 0.24
23 0.21
24 0.21
25 0.23
26 0.25
27 0.3
28 0.38
29 0.45
30 0.51
31 0.6
32 0.66
33 0.73
34 0.82
35 0.81
36 0.84
37 0.86
38 0.86
39 0.86
40 0.88
41 0.88
42 0.79
43 0.71
44 0.62
45 0.53
46 0.46
47 0.36
48 0.28
49 0.22
50 0.22
51 0.21
52 0.22
53 0.23
54 0.23
55 0.24
56 0.29
57 0.28
58 0.34