Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2P801

Protein Details
Accession A0A2T2P801    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-72QPPPSGKEYKKTKRNRDFPHRESNPGBasic
NLS Segment(s)
PositionSequence
51-80SGKEYKKTKRNRDFPHRESNPGHVGSRKAR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MATRGVLREACRKCSYKGCVHGPILPSLKNSTLRFHPKTERKMIQAQPPPSGKEYKKTKRNRDFPHRESNPGHVGSRKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.54
3 0.53
4 0.58
5 0.58
6 0.58
7 0.57
8 0.57
9 0.49
10 0.48
11 0.42
12 0.34
13 0.29
14 0.25
15 0.26
16 0.29
17 0.28
18 0.26
19 0.3
20 0.38
21 0.39
22 0.42
23 0.48
24 0.49
25 0.54
26 0.59
27 0.55
28 0.51
29 0.56
30 0.56
31 0.55
32 0.55
33 0.51
34 0.49
35 0.48
36 0.46
37 0.4
38 0.43
39 0.35
40 0.37
41 0.46
42 0.5
43 0.57
44 0.66
45 0.74
46 0.78
47 0.87
48 0.89
49 0.89
50 0.9
51 0.87
52 0.88
53 0.8
54 0.77
55 0.7
56 0.66
57 0.61
58 0.54
59 0.5
60 0.42