Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P895

Protein Details
Accession A0A2T2P895    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QASKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRSKEFRGTAKTKGASKKDKK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSQVTLRTRKFIRNPLLGRRQMVVDVLHPNRANVSKDELREKLGQLYKAKKDDVSVFGFKTHFGGGKSTGFALIYDSSEAMKKFEPHYRLVRYGQASKIEKASRQQRKQRKNRSKEFRGTAKTKGASKKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.71
5 0.77
6 0.72
7 0.66
8 0.58
9 0.5
10 0.41
11 0.37
12 0.27
13 0.21
14 0.25
15 0.24
16 0.28
17 0.27
18 0.26
19 0.28
20 0.3
21 0.29
22 0.22
23 0.29
24 0.27
25 0.3
26 0.36
27 0.33
28 0.34
29 0.34
30 0.33
31 0.33
32 0.32
33 0.34
34 0.34
35 0.4
36 0.42
37 0.43
38 0.43
39 0.35
40 0.34
41 0.33
42 0.31
43 0.29
44 0.25
45 0.23
46 0.23
47 0.23
48 0.2
49 0.18
50 0.15
51 0.11
52 0.1
53 0.11
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.12
72 0.15
73 0.21
74 0.23
75 0.27
76 0.34
77 0.37
78 0.4
79 0.4
80 0.43
81 0.41
82 0.42
83 0.41
84 0.42
85 0.4
86 0.37
87 0.42
88 0.38
89 0.37
90 0.41
91 0.48
92 0.51
93 0.58
94 0.67
95 0.71
96 0.8
97 0.88
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.65
113 0.66
114 0.65