Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NBY3

Protein Details
Accession A0A2T2NBY3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-30DRSWTCPTKRHTPKPHWGVKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, plas 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATAIGTGIDRSWTCPTKRHTPKPHWGVKYVLGYLIYRYFGFFAVIIANRVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.37
4 0.45
5 0.55
6 0.62
7 0.66
8 0.7
9 0.78
10 0.81
11 0.83
12 0.75
13 0.67
14 0.58
15 0.53
16 0.47
17 0.37
18 0.29
19 0.21
20 0.19
21 0.18
22 0.17
23 0.14
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.1
30 0.09
31 0.12
32 0.13