Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NHA4

Protein Details
Accession A0A2T2NHA4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-83DTQSPGPEPRRKKRFPSFSWAGHydrophilic
NLS Segment(s)
PositionSequence
72-73RK
Subcellular Location(s) nucl 17, cyto 4.5, cyto_mito 4, mito 2.5
Family & Domain DBs
Amino Acid Sequences MRVLNTYASIVEDYSTRTLTFDSDTLNAFAGVLTMLLNTIDSKSVGGLIDSLLDHCLLWTHDTQSPGPEPRRKKRFPSFSWAGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.12
5 0.12
6 0.13
7 0.14
8 0.12
9 0.12
10 0.12
11 0.13
12 0.13
13 0.13
14 0.12
15 0.1
16 0.09
17 0.07
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.08
46 0.09
47 0.12
48 0.15
49 0.17
50 0.18
51 0.21
52 0.25
53 0.3
54 0.36
55 0.41
56 0.48
57 0.57
58 0.67
59 0.7
60 0.75
61 0.79
62 0.82
63 0.8
64 0.81