Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P3P1

Protein Details
Accession A0A2T2P3P1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
12-35ILLPAPRSIRRKRSRQVPIGRTVQHydrophilic
NLS Segment(s)
PositionSequence
19-28SIRRKRSRQV
42-42R
46-57HPLPLQKKRPPL
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MNTRPTVFETSILLPAPRSIRRKRSRQVPIGRTVQPPTVPRRSTPHPLPLQKKRPPLGRQPASPRYIAFHSPPRPAQGAHRILNAHHPSSIAQRSPRLHSTRFGGSRTMPRMLDPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.24
4 0.27
5 0.33
6 0.39
7 0.49
8 0.58
9 0.68
10 0.74
11 0.79
12 0.82
13 0.84
14 0.86
15 0.82
16 0.8
17 0.77
18 0.72
19 0.65
20 0.57
21 0.49
22 0.42
23 0.4
24 0.39
25 0.41
26 0.38
27 0.37
28 0.41
29 0.44
30 0.48
31 0.48
32 0.5
33 0.5
34 0.57
35 0.63
36 0.66
37 0.7
38 0.69
39 0.72
40 0.68
41 0.68
42 0.65
43 0.66
44 0.67
45 0.62
46 0.61
47 0.62
48 0.63
49 0.56
50 0.52
51 0.42
52 0.35
53 0.33
54 0.29
55 0.24
56 0.26
57 0.28
58 0.32
59 0.33
60 0.33
61 0.32
62 0.31
63 0.33
64 0.34
65 0.37
66 0.35
67 0.37
68 0.34
69 0.33
70 0.42
71 0.4
72 0.31
73 0.25
74 0.24
75 0.22
76 0.28
77 0.33
78 0.27
79 0.27
80 0.32
81 0.36
82 0.41
83 0.48
84 0.47
85 0.44
86 0.44
87 0.46
88 0.49
89 0.49
90 0.45
91 0.4
92 0.4
93 0.46
94 0.47
95 0.47
96 0.37
97 0.36