Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2N1N1

Protein Details
Accession A0A2T2N1N1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
138-162ENSGHTGRTTKVRKRKKRSVHLRNVBasic
NLS Segment(s)
PositionSequence
148-156KVRKRKKRS
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MGTDDSRSPHAEKKKDFERLRLQAHVTVPTLLALHALNSDSPSAVTAEHAHARDFFPASPPTTPEFVIETARISPTPSPSLPDLHNKAIPTREEGEKSGSIRETRSKRPQSQATMFMSTHHMITRNKRKLLQSVETFENSGHTGRTTKVRKRKKRSVHLRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.69
3 0.69
4 0.7
5 0.71
6 0.7
7 0.7
8 0.66
9 0.6
10 0.54
11 0.53
12 0.47
13 0.38
14 0.3
15 0.24
16 0.2
17 0.18
18 0.12
19 0.11
20 0.08
21 0.07
22 0.07
23 0.08
24 0.07
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.11
35 0.15
36 0.15
37 0.15
38 0.16
39 0.17
40 0.17
41 0.17
42 0.14
43 0.14
44 0.16
45 0.17
46 0.16
47 0.18
48 0.19
49 0.19
50 0.19
51 0.16
52 0.16
53 0.15
54 0.16
55 0.14
56 0.12
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.11
63 0.14
64 0.13
65 0.15
66 0.15
67 0.17
68 0.18
69 0.24
70 0.25
71 0.24
72 0.26
73 0.24
74 0.25
75 0.25
76 0.24
77 0.21
78 0.21
79 0.21
80 0.21
81 0.21
82 0.24
83 0.23
84 0.23
85 0.21
86 0.2
87 0.18
88 0.19
89 0.26
90 0.28
91 0.35
92 0.44
93 0.51
94 0.55
95 0.63
96 0.68
97 0.68
98 0.67
99 0.65
100 0.59
101 0.54
102 0.48
103 0.41
104 0.38
105 0.3
106 0.26
107 0.21
108 0.22
109 0.22
110 0.33
111 0.42
112 0.46
113 0.5
114 0.55
115 0.58
116 0.61
117 0.65
118 0.63
119 0.58
120 0.55
121 0.55
122 0.51
123 0.47
124 0.39
125 0.33
126 0.26
127 0.2
128 0.15
129 0.13
130 0.13
131 0.15
132 0.25
133 0.33
134 0.41
135 0.51
136 0.62
137 0.71
138 0.8
139 0.89
140 0.9
141 0.92
142 0.94