Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7UWE2

Protein Details
Accession A7UWE2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
328-351DTSVEERRRERTRERGRGREEIVRBasic
NLS Segment(s)
PositionSequence
262-355KGEGRQKGGRSGRKESVKRVAKGMVRDYDKWEKGNADGGKGTGGKKEKAGKSSERGRRASREERERDTSVEERRRERTRERGRGREEIVRGRRR
Subcellular Location(s) cyto 12, cyto_nucl 11.833, nucl 9.5, mito_nucl 7.666, mito 4.5
Family & Domain DBs
KEGG ncr:NCU10457  -  
Amino Acid Sequences MHALLVHEAEQDDHPLLVLSRCVHAHQWIEVVGSQCDQTTEQAITEENPYDQNRGGNQIMKHQTPKQLSLLAPADAASTGHQHLHIEVQLFTTLTIPVHVQGPAQHPITTSTTPTTSGKKTHTTTTTPDPTTAAHTPNPPSTSRRPSLNLATLKSSPKTASLLKAASRALEAGAATALKLRKDSPSTPLFSAQSGSKIAAAALGAAVVDGLIEHEQRRHPKLMRKGGLRHHVVKQVVQRGVAGLVGGILEEGLAGGGGGDEKGEGRQKGGRSGRKESVKRVAKGMVRDYDKWEKGNADGGKGTGGKKEKAGKSSERGRRASREERERDTSVEERRRERTRERGRGREEIVRGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.15
6 0.13
7 0.15
8 0.17
9 0.19
10 0.21
11 0.25
12 0.26
13 0.24
14 0.25
15 0.23
16 0.23
17 0.23
18 0.23
19 0.19
20 0.17
21 0.16
22 0.14
23 0.15
24 0.14
25 0.13
26 0.14
27 0.13
28 0.13
29 0.14
30 0.14
31 0.14
32 0.16
33 0.16
34 0.14
35 0.18
36 0.19
37 0.21
38 0.22
39 0.24
40 0.22
41 0.27
42 0.29
43 0.29
44 0.29
45 0.35
46 0.4
47 0.4
48 0.45
49 0.44
50 0.49
51 0.48
52 0.51
53 0.45
54 0.44
55 0.4
56 0.41
57 0.38
58 0.31
59 0.26
60 0.23
61 0.2
62 0.14
63 0.15
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.11
71 0.13
72 0.14
73 0.13
74 0.13
75 0.13
76 0.13
77 0.13
78 0.12
79 0.1
80 0.09
81 0.08
82 0.08
83 0.07
84 0.08
85 0.09
86 0.09
87 0.09
88 0.12
89 0.16
90 0.2
91 0.21
92 0.2
93 0.19
94 0.22
95 0.26
96 0.24
97 0.21
98 0.19
99 0.18
100 0.2
101 0.22
102 0.23
103 0.22
104 0.25
105 0.27
106 0.32
107 0.34
108 0.37
109 0.39
110 0.38
111 0.39
112 0.44
113 0.47
114 0.41
115 0.39
116 0.34
117 0.3
118 0.32
119 0.3
120 0.24
121 0.2
122 0.22
123 0.24
124 0.27
125 0.28
126 0.25
127 0.28
128 0.32
129 0.37
130 0.37
131 0.38
132 0.38
133 0.4
134 0.43
135 0.45
136 0.41
137 0.35
138 0.36
139 0.34
140 0.33
141 0.3
142 0.26
143 0.19
144 0.17
145 0.19
146 0.17
147 0.17
148 0.18
149 0.2
150 0.19
151 0.22
152 0.2
153 0.17
154 0.16
155 0.13
156 0.1
157 0.09
158 0.07
159 0.05
160 0.05
161 0.04
162 0.04
163 0.06
164 0.07
165 0.07
166 0.08
167 0.09
168 0.12
169 0.16
170 0.17
171 0.2
172 0.24
173 0.27
174 0.27
175 0.29
176 0.26
177 0.23
178 0.23
179 0.18
180 0.15
181 0.13
182 0.12
183 0.1
184 0.09
185 0.08
186 0.07
187 0.07
188 0.05
189 0.04
190 0.03
191 0.03
192 0.03
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.03
199 0.04
200 0.05
201 0.08
202 0.12
203 0.17
204 0.22
205 0.27
206 0.32
207 0.4
208 0.5
209 0.58
210 0.61
211 0.62
212 0.65
213 0.67
214 0.7
215 0.67
216 0.61
217 0.55
218 0.54
219 0.49
220 0.46
221 0.44
222 0.43
223 0.39
224 0.35
225 0.3
226 0.25
227 0.24
228 0.2
229 0.14
230 0.06
231 0.05
232 0.04
233 0.04
234 0.03
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.02
245 0.02
246 0.02
247 0.03
248 0.03
249 0.06
250 0.11
251 0.11
252 0.13
253 0.18
254 0.2
255 0.29
256 0.38
257 0.43
258 0.45
259 0.52
260 0.58
261 0.64
262 0.67
263 0.65
264 0.66
265 0.67
266 0.63
267 0.6
268 0.58
269 0.52
270 0.54
271 0.53
272 0.51
273 0.47
274 0.47
275 0.51
276 0.53
277 0.52
278 0.48
279 0.44
280 0.37
281 0.34
282 0.4
283 0.34
284 0.27
285 0.25
286 0.24
287 0.24
288 0.25
289 0.25
290 0.23
291 0.26
292 0.25
293 0.3
294 0.4
295 0.42
296 0.45
297 0.51
298 0.51
299 0.56
300 0.64
301 0.68
302 0.67
303 0.68
304 0.69
305 0.7
306 0.72
307 0.74
308 0.73
309 0.75
310 0.74
311 0.75
312 0.76
313 0.7
314 0.63
315 0.59
316 0.56
317 0.55
318 0.57
319 0.56
320 0.55
321 0.61
322 0.66
323 0.67
324 0.69
325 0.7
326 0.73
327 0.78
328 0.81
329 0.83
330 0.82
331 0.83
332 0.8
333 0.78
334 0.73
335 0.73