Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IMC5

Protein Details
Accession V5IMC5    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
171-198VYSTSTCVHRRKLRNRVKRWIRLKLTIDHydrophilic
NLS Segment(s)
PositionSequence
182-186KLRNR
Subcellular Location(s) mito 10.5, cyto_mito 9.5, cyto 7.5, plas 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG ncr:NCU10500  -  
Amino Acid Sequences MASPTRRYKSRPALPCPAPQIPGSDPLNSTTPDGQPASNAELLTTLSEHASLEHKPYADVHDGLTSPAARKSSFMELPAEIHLLVTEQLIYPDALSMKHVNRYFYNLVDTGVRKKVEWLVQCRRLHLGCPNHRSCDLGSDVRFCRGSVKLLMQRWREHNECEARPGLGCLVYSTSTCVHRRKLRNRVKRWIRLKLTIDIPLLILALLVVLGAWWAVPLFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.73
4 0.66
5 0.58
6 0.5
7 0.46
8 0.38
9 0.41
10 0.35
11 0.3
12 0.27
13 0.28
14 0.3
15 0.25
16 0.26
17 0.22
18 0.21
19 0.23
20 0.24
21 0.21
22 0.2
23 0.21
24 0.22
25 0.21
26 0.2
27 0.15
28 0.15
29 0.15
30 0.14
31 0.12
32 0.09
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.1
39 0.13
40 0.15
41 0.15
42 0.15
43 0.16
44 0.19
45 0.2
46 0.2
47 0.17
48 0.17
49 0.17
50 0.17
51 0.17
52 0.13
53 0.11
54 0.13
55 0.14
56 0.12
57 0.12
58 0.15
59 0.2
60 0.21
61 0.21
62 0.21
63 0.2
64 0.21
65 0.21
66 0.18
67 0.12
68 0.1
69 0.09
70 0.07
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.07
83 0.1
84 0.11
85 0.17
86 0.19
87 0.2
88 0.2
89 0.26
90 0.26
91 0.23
92 0.24
93 0.18
94 0.17
95 0.17
96 0.18
97 0.15
98 0.17
99 0.17
100 0.15
101 0.16
102 0.19
103 0.22
104 0.26
105 0.32
106 0.37
107 0.45
108 0.46
109 0.46
110 0.45
111 0.4
112 0.37
113 0.37
114 0.38
115 0.37
116 0.45
117 0.46
118 0.46
119 0.45
120 0.45
121 0.38
122 0.32
123 0.27
124 0.23
125 0.22
126 0.24
127 0.25
128 0.26
129 0.26
130 0.22
131 0.22
132 0.19
133 0.21
134 0.18
135 0.25
136 0.28
137 0.33
138 0.41
139 0.42
140 0.45
141 0.48
142 0.52
143 0.47
144 0.43
145 0.46
146 0.47
147 0.43
148 0.42
149 0.38
150 0.32
151 0.3
152 0.28
153 0.21
154 0.14
155 0.13
156 0.1
157 0.11
158 0.11
159 0.11
160 0.12
161 0.14
162 0.18
163 0.24
164 0.28
165 0.34
166 0.43
167 0.54
168 0.62
169 0.71
170 0.76
171 0.82
172 0.87
173 0.89
174 0.9
175 0.9
176 0.89
177 0.89
178 0.85
179 0.83
180 0.78
181 0.74
182 0.67
183 0.62
184 0.54
185 0.44
186 0.37
187 0.28
188 0.23
189 0.16
190 0.12
191 0.06
192 0.04
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02