Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NYD5

Protein Details
Accession A0A2T2NYD5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQVTRCHSLRTRPRPRPPSPQPCMHAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MQVTRCHSLRTRPRPRPPSPQPCMHARNLPASAQKPQTCIQTPVSPILFLEGQANRQSKTPQGSVCTQGPNALPKPPTSNLQNKTQTFCKRLFLTRHRPPSSPSALPPPRKPSAVFLLFFSTQTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.89
5 0.88
6 0.84
7 0.82
8 0.75
9 0.74
10 0.72
11 0.65
12 0.6
13 0.52
14 0.51
15 0.45
16 0.43
17 0.4
18 0.37
19 0.39
20 0.4
21 0.38
22 0.36
23 0.36
24 0.39
25 0.36
26 0.37
27 0.35
28 0.32
29 0.32
30 0.33
31 0.31
32 0.24
33 0.21
34 0.2
35 0.16
36 0.12
37 0.14
38 0.11
39 0.12
40 0.17
41 0.19
42 0.17
43 0.18
44 0.19
45 0.18
46 0.22
47 0.23
48 0.19
49 0.21
50 0.23
51 0.25
52 0.26
53 0.25
54 0.2
55 0.2
56 0.19
57 0.21
58 0.2
59 0.19
60 0.18
61 0.18
62 0.23
63 0.23
64 0.26
65 0.27
66 0.35
67 0.35
68 0.43
69 0.5
70 0.47
71 0.5
72 0.54
73 0.55
74 0.49
75 0.48
76 0.44
77 0.4
78 0.45
79 0.5
80 0.52
81 0.56
82 0.62
83 0.71
84 0.69
85 0.67
86 0.64
87 0.63
88 0.6
89 0.53
90 0.47
91 0.47
92 0.52
93 0.57
94 0.61
95 0.6
96 0.58
97 0.57
98 0.55
99 0.51
100 0.52
101 0.5
102 0.44
103 0.39
104 0.41
105 0.39