Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P309

Protein Details
Accession A0A2T2P309   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
234-270TETKGKKAGRPKSAENKEKSKSARKREPKKAATADGQHydrophilic
NLS Segment(s)
PositionSequence
194-210KAKEKEAEAPKTGTKRK
236-279TKGKKAGRPKSAENKEKSKSARKREPKKAATADGQPRRSARNRS
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MAETQVQQGDKVSWKWSGSRPGGEVAEVKDQGELAIESNKGNTIKKNADPENPAVHIERPGNDVVKRASEIDVEEKANGADDQQANGESKDETQPEPEKKDEEKPAEAEKKEDEKPAESEKKDEDMKDAPPAEDKEAEPEKAVDDKKDESAETNGTSESKDEVNKDDSKDEEKPETNGESKEESKEEKQPETPKAKEKEAEAPKTGTKRKAEASPEEEAHSAEEEEPTSKKQNTETKGKKAGRPKSAENKEKSKSARKREPKKAATADGQPRRSARNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.38
4 0.44
5 0.44
6 0.46
7 0.45
8 0.45
9 0.44
10 0.4
11 0.36
12 0.3
13 0.31
14 0.27
15 0.25
16 0.21
17 0.2
18 0.18
19 0.17
20 0.14
21 0.08
22 0.11
23 0.12
24 0.12
25 0.13
26 0.16
27 0.17
28 0.19
29 0.22
30 0.26
31 0.32
32 0.36
33 0.45
34 0.46
35 0.5
36 0.52
37 0.53
38 0.51
39 0.46
40 0.43
41 0.36
42 0.32
43 0.3
44 0.27
45 0.24
46 0.22
47 0.23
48 0.24
49 0.23
50 0.25
51 0.22
52 0.22
53 0.22
54 0.2
55 0.19
56 0.17
57 0.18
58 0.19
59 0.2
60 0.18
61 0.17
62 0.16
63 0.15
64 0.15
65 0.12
66 0.09
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.14
73 0.14
74 0.14
75 0.09
76 0.1
77 0.13
78 0.14
79 0.14
80 0.18
81 0.25
82 0.28
83 0.32
84 0.32
85 0.33
86 0.33
87 0.4
88 0.42
89 0.4
90 0.38
91 0.37
92 0.43
93 0.46
94 0.43
95 0.38
96 0.35
97 0.36
98 0.35
99 0.36
100 0.29
101 0.25
102 0.28
103 0.35
104 0.38
105 0.33
106 0.33
107 0.31
108 0.34
109 0.33
110 0.3
111 0.25
112 0.21
113 0.21
114 0.23
115 0.22
116 0.19
117 0.2
118 0.2
119 0.19
120 0.18
121 0.17
122 0.18
123 0.19
124 0.19
125 0.16
126 0.15
127 0.15
128 0.17
129 0.18
130 0.13
131 0.14
132 0.15
133 0.16
134 0.17
135 0.16
136 0.13
137 0.14
138 0.15
139 0.13
140 0.12
141 0.11
142 0.11
143 0.11
144 0.09
145 0.09
146 0.09
147 0.1
148 0.1
149 0.13
150 0.17
151 0.2
152 0.21
153 0.21
154 0.21
155 0.24
156 0.26
157 0.26
158 0.26
159 0.25
160 0.25
161 0.26
162 0.27
163 0.25
164 0.23
165 0.23
166 0.22
167 0.22
168 0.23
169 0.22
170 0.23
171 0.24
172 0.31
173 0.32
174 0.31
175 0.36
176 0.4
177 0.46
178 0.5
179 0.51
180 0.52
181 0.53
182 0.54
183 0.5
184 0.48
185 0.5
186 0.51
187 0.51
188 0.45
189 0.44
190 0.44
191 0.49
192 0.52
193 0.49
194 0.43
195 0.43
196 0.45
197 0.49
198 0.51
199 0.5
200 0.49
201 0.48
202 0.46
203 0.43
204 0.39
205 0.32
206 0.27
207 0.21
208 0.17
209 0.12
210 0.11
211 0.1
212 0.12
213 0.13
214 0.16
215 0.2
216 0.22
217 0.23
218 0.3
219 0.38
220 0.42
221 0.52
222 0.57
223 0.6
224 0.69
225 0.72
226 0.71
227 0.73
228 0.76
229 0.75
230 0.73
231 0.74
232 0.74
233 0.79
234 0.82
235 0.79
236 0.79
237 0.74
238 0.75
239 0.73
240 0.73
241 0.72
242 0.74
243 0.77
244 0.79
245 0.86
246 0.89
247 0.92
248 0.89
249 0.9
250 0.86
251 0.82
252 0.77
253 0.76
254 0.76
255 0.74
256 0.7
257 0.64
258 0.59
259 0.61