Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NDP7

Protein Details
Accession A0A2T2NDP7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-44APRPRSRARSCGRGRGRRRRRRPPPSPCPAAABasic
NLS Segment(s)
PositionSequence
14-36PRPRSRARSCGRGRGRRRRRRPP
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MGDLTSPSTPASAPRPRSRARSCGRGRGRRRRRRPPPSPCPAAAAFGQVCPRTACMQHGWAASVCQRSHGAHSHMAVVTAEVQSLSRSLGWRRQSGQGPMSIRWLHAASGLEPRANPAAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.55
4 0.64
5 0.67
6 0.69
7 0.67
8 0.7
9 0.67
10 0.71
11 0.76
12 0.77
13 0.81
14 0.82
15 0.87
16 0.87
17 0.92
18 0.92
19 0.93
20 0.94
21 0.94
22 0.94
23 0.93
24 0.91
25 0.86
26 0.76
27 0.69
28 0.59
29 0.5
30 0.39
31 0.32
32 0.23
33 0.18
34 0.2
35 0.15
36 0.15
37 0.14
38 0.15
39 0.13
40 0.14
41 0.15
42 0.13
43 0.15
44 0.17
45 0.17
46 0.16
47 0.15
48 0.15
49 0.15
50 0.17
51 0.15
52 0.14
53 0.15
54 0.15
55 0.18
56 0.21
57 0.21
58 0.2
59 0.21
60 0.21
61 0.2
62 0.19
63 0.16
64 0.13
65 0.11
66 0.09
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.09
75 0.12
76 0.19
77 0.24
78 0.28
79 0.31
80 0.37
81 0.41
82 0.45
83 0.44
84 0.43
85 0.42
86 0.39
87 0.42
88 0.36
89 0.31
90 0.28
91 0.26
92 0.2
93 0.2
94 0.21
95 0.16
96 0.24
97 0.25
98 0.23
99 0.22
100 0.26
101 0.26