Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2PAU8

Protein Details
Accession A0A2T2PAU8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-36EESPYESTSHRPRKRQRQSQQSIVGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSDHPSVSESEESPYESTSHRPRKRQRQSQQSIVGPTSLQCQVCSRTYERADHLNRHLDSHRNERPFRCEECPAAFNRRDLLLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.15
4 0.21
5 0.29
6 0.39
7 0.44
8 0.53
9 0.63
10 0.73
11 0.83
12 0.87
13 0.87
14 0.87
15 0.88
16 0.87
17 0.84
18 0.76
19 0.67
20 0.56
21 0.47
22 0.35
23 0.28
24 0.21
25 0.17
26 0.14
27 0.11
28 0.13
29 0.15
30 0.17
31 0.2
32 0.19
33 0.22
34 0.24
35 0.27
36 0.27
37 0.33
38 0.35
39 0.37
40 0.39
41 0.4
42 0.38
43 0.39
44 0.4
45 0.38
46 0.39
47 0.44
48 0.48
49 0.47
50 0.51
51 0.51
52 0.55
53 0.54
54 0.54
55 0.5
56 0.47
57 0.45
58 0.46
59 0.46
60 0.44
61 0.46
62 0.44
63 0.4
64 0.38
65 0.37