Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NES2

Protein Details
Accession A0A2T2NES2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
149-187AIADWEKKEKKEKKEKKEKKEKENKKRERGARRFRYPGIBasic
NLS Segment(s)
PositionSequence
155-183KKEKKEKKEKKEKKEKENKKRERGARRFR
Subcellular Location(s) cyto 13, nucl 11, mito 2
Family & Domain DBs
Amino Acid Sequences MEKLSFLAGMATMSGIAHITVGAKNMAAAAKPDPKASTNSHALKTKMEGPAASLKNVDGNPDLRVELSNDSGHVKLGQLFEIHPGNLPYNVDIKIKNGSGVLDLRPDRSNSWSIASGCITGITIGGMAFYYRNELRIIGRGVWAMLNLAIADWEKKEKKEKKEKKEKKEKENKKRERGARRFRYPGILPSSGEEEYTTDSFDTPSDNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.05
6 0.06
7 0.07
8 0.08
9 0.08
10 0.08
11 0.08
12 0.1
13 0.1
14 0.09
15 0.1
16 0.14
17 0.21
18 0.22
19 0.24
20 0.25
21 0.26
22 0.3
23 0.33
24 0.35
25 0.36
26 0.4
27 0.43
28 0.46
29 0.45
30 0.42
31 0.41
32 0.4
33 0.35
34 0.31
35 0.26
36 0.24
37 0.33
38 0.32
39 0.29
40 0.24
41 0.2
42 0.23
43 0.24
44 0.22
45 0.15
46 0.15
47 0.16
48 0.16
49 0.16
50 0.12
51 0.13
52 0.12
53 0.12
54 0.13
55 0.12
56 0.12
57 0.13
58 0.13
59 0.13
60 0.11
61 0.1
62 0.11
63 0.11
64 0.11
65 0.1
66 0.1
67 0.13
68 0.14
69 0.13
70 0.11
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.11
77 0.12
78 0.13
79 0.12
80 0.13
81 0.14
82 0.14
83 0.14
84 0.12
85 0.1
86 0.11
87 0.12
88 0.11
89 0.13
90 0.13
91 0.15
92 0.15
93 0.16
94 0.16
95 0.17
96 0.19
97 0.15
98 0.17
99 0.18
100 0.17
101 0.18
102 0.17
103 0.14
104 0.12
105 0.11
106 0.09
107 0.06
108 0.05
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.07
118 0.07
119 0.09
120 0.09
121 0.1
122 0.11
123 0.16
124 0.18
125 0.15
126 0.16
127 0.15
128 0.15
129 0.14
130 0.12
131 0.08
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.05
138 0.06
139 0.06
140 0.13
141 0.16
142 0.2
143 0.3
144 0.38
145 0.49
146 0.59
147 0.69
148 0.73
149 0.82
150 0.9
151 0.91
152 0.94
153 0.93
154 0.93
155 0.94
156 0.94
157 0.94
158 0.95
159 0.94
160 0.93
161 0.93
162 0.92
163 0.92
164 0.92
165 0.91
166 0.91
167 0.89
168 0.86
169 0.78
170 0.77
171 0.68
172 0.65
173 0.61
174 0.53
175 0.44
176 0.4
177 0.41
178 0.34
179 0.31
180 0.23
181 0.17
182 0.2
183 0.19
184 0.18
185 0.14
186 0.14
187 0.14
188 0.14