Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P039

Protein Details
Accession A0A2T2P039    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-52LLNRLFARNRNQHRRNHWFKSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 7, plas 4, nucl 3, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR047205  RMP1  
IPR047204  RMP1_RBD  
Gene Ontology GO:0016020  C:membrane  
GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
CDD cd22573  RMP1_RBD  
Amino Acid Sequences MDPGKTGPQISSKPLLSASGRDKQALSDILELLNRLFARNRNQHRRNHWFKSLHQFRKQLGMLVDELETTKKSALAEKIELRLRFWDQKCIHQWYLHFTQLVAVGPFAVLGLVLMACTARICRITGITSLYEEIGSEDMRAVLTSVDEGSVAEEFGGLLDEDHWDEGEVIERDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.28
4 0.31
5 0.32
6 0.34
7 0.35
8 0.35
9 0.34
10 0.31
11 0.34
12 0.3
13 0.26
14 0.2
15 0.19
16 0.19
17 0.19
18 0.19
19 0.14
20 0.15
21 0.13
22 0.12
23 0.14
24 0.18
25 0.27
26 0.37
27 0.47
28 0.55
29 0.62
30 0.69
31 0.76
32 0.82
33 0.82
34 0.79
35 0.78
36 0.72
37 0.7
38 0.73
39 0.74
40 0.72
41 0.7
42 0.68
43 0.59
44 0.63
45 0.57
46 0.5
47 0.4
48 0.33
49 0.25
50 0.22
51 0.21
52 0.12
53 0.12
54 0.09
55 0.09
56 0.07
57 0.07
58 0.07
59 0.08
60 0.11
61 0.14
62 0.16
63 0.19
64 0.21
65 0.25
66 0.29
67 0.28
68 0.25
69 0.25
70 0.25
71 0.3
72 0.28
73 0.34
74 0.31
75 0.37
76 0.41
77 0.45
78 0.43
79 0.37
80 0.37
81 0.33
82 0.36
83 0.31
84 0.26
85 0.2
86 0.19
87 0.19
88 0.19
89 0.13
90 0.08
91 0.06
92 0.06
93 0.06
94 0.05
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.04
107 0.06
108 0.06
109 0.08
110 0.09
111 0.11
112 0.13
113 0.15
114 0.14
115 0.14
116 0.14
117 0.14
118 0.12
119 0.1
120 0.1
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.04
145 0.04
146 0.05
147 0.07
148 0.08
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.15