Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SEW6

Protein Details
Accession Q7SEW6   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-23NVMLPRREKGRKMKGDRGPIWBasic
NLS Segment(s)
PositionSequence
9-16REKGRKMK
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 3
Family & Domain DBs
KEGG ncr:NCU03165  -  
Amino Acid Sequences MGNVMLPRREKGRKMKGDRGPIWVGFLASFYKDFGLQCHWPVEAVVTSSKASMPSVITHCREMPIWRDYGSNGWRAGRNGGRRSEGWRFGFCSAHASSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.8
4 0.84
5 0.78
6 0.74
7 0.67
8 0.57
9 0.5
10 0.41
11 0.33
12 0.22
13 0.2
14 0.14
15 0.11
16 0.11
17 0.08
18 0.08
19 0.09
20 0.09
21 0.1
22 0.14
23 0.15
24 0.16
25 0.17
26 0.16
27 0.15
28 0.15
29 0.14
30 0.09
31 0.09
32 0.08
33 0.08
34 0.08
35 0.08
36 0.09
37 0.08
38 0.08
39 0.07
40 0.08
41 0.09
42 0.12
43 0.16
44 0.18
45 0.19
46 0.19
47 0.19
48 0.2
49 0.19
50 0.2
51 0.19
52 0.19
53 0.18
54 0.18
55 0.18
56 0.24
57 0.24
58 0.23
59 0.22
60 0.24
61 0.25
62 0.26
63 0.31
64 0.32
65 0.38
66 0.4
67 0.42
68 0.44
69 0.43
70 0.49
71 0.51
72 0.52
73 0.48
74 0.45
75 0.44
76 0.43
77 0.43
78 0.37
79 0.34
80 0.27