Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NL63

Protein Details
Accession A0A2T2NL63    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-101ASATAGPNRQRRRPRKLNREPASTPAHydrophilic
145-169AVDRSGRSPRRRGKGRKNSGQQIPTHydrophilic
NLS Segment(s)
PositionSequence
84-92RQRRRPRKL
150-161GRSPRRRGKGRK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPTKSQSPGPNPTSSAPKVARSRKAAISQSEQTTTGRAGSAGGIVLSKEQPAKAMSPANPANAPSPPPLANDAAAASATAGPNRQRRRPRKLNREPASTPATDSTKSTSTPAKDTAVPSAAELEALKSRVRGLEAKVEELYNNGAVDRSGRSPRRRGKGRKNSGQQIPTTSSVTGTGRVEELEEADEELVRLEGELEVARRDLDTYRQPRPRTKRSQSSETDFVEEIPRGGVGYEDTTGSEDRQVTLTGNYRIPLPANVSMNDVKNIQSGVTAAHNVARSFLEQRRAQQAAQSPKVGPTKTATSKTATSKTKPAAGSTAVSTEAGGQQSWSEWFGGYSMAISRAVSKIEAEAAIESQRARPTAGPRRSSAPGAKSTSGTAKTAAKAGTQRPPLKQRQGNLSSEQVNGLMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.44
4 0.47
5 0.53
6 0.59
7 0.64
8 0.62
9 0.66
10 0.65
11 0.7
12 0.69
13 0.65
14 0.64
15 0.62
16 0.6
17 0.56
18 0.5
19 0.42
20 0.37
21 0.31
22 0.25
23 0.18
24 0.14
25 0.12
26 0.11
27 0.11
28 0.1
29 0.09
30 0.08
31 0.07
32 0.1
33 0.1
34 0.12
35 0.13
36 0.13
37 0.15
38 0.17
39 0.18
40 0.21
41 0.27
42 0.26
43 0.33
44 0.35
45 0.36
46 0.35
47 0.35
48 0.33
49 0.28
50 0.29
51 0.23
52 0.25
53 0.23
54 0.24
55 0.26
56 0.25
57 0.23
58 0.21
59 0.19
60 0.15
61 0.14
62 0.12
63 0.09
64 0.09
65 0.09
66 0.09
67 0.11
68 0.17
69 0.26
70 0.33
71 0.42
72 0.51
73 0.6
74 0.71
75 0.79
76 0.84
77 0.87
78 0.91
79 0.94
80 0.9
81 0.89
82 0.8
83 0.75
84 0.69
85 0.58
86 0.49
87 0.42
88 0.36
89 0.28
90 0.27
91 0.25
92 0.22
93 0.22
94 0.23
95 0.24
96 0.24
97 0.27
98 0.29
99 0.27
100 0.28
101 0.29
102 0.3
103 0.27
104 0.24
105 0.2
106 0.2
107 0.17
108 0.14
109 0.13
110 0.11
111 0.1
112 0.12
113 0.12
114 0.1
115 0.11
116 0.12
117 0.14
118 0.16
119 0.16
120 0.24
121 0.25
122 0.27
123 0.26
124 0.26
125 0.23
126 0.21
127 0.19
128 0.11
129 0.1
130 0.08
131 0.07
132 0.07
133 0.08
134 0.09
135 0.12
136 0.19
137 0.26
138 0.32
139 0.41
140 0.5
141 0.59
142 0.67
143 0.74
144 0.77
145 0.82
146 0.87
147 0.87
148 0.87
149 0.86
150 0.83
151 0.76
152 0.66
153 0.59
154 0.52
155 0.44
156 0.36
157 0.28
158 0.21
159 0.19
160 0.18
161 0.16
162 0.13
163 0.11
164 0.1
165 0.1
166 0.1
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.06
190 0.1
191 0.18
192 0.22
193 0.31
194 0.37
195 0.4
196 0.48
197 0.57
198 0.63
199 0.66
200 0.69
201 0.71
202 0.72
203 0.77
204 0.73
205 0.7
206 0.66
207 0.56
208 0.5
209 0.4
210 0.34
211 0.27
212 0.22
213 0.16
214 0.1
215 0.09
216 0.06
217 0.06
218 0.05
219 0.04
220 0.05
221 0.05
222 0.06
223 0.06
224 0.07
225 0.08
226 0.08
227 0.1
228 0.09
229 0.09
230 0.1
231 0.1
232 0.1
233 0.12
234 0.16
235 0.16
236 0.17
237 0.17
238 0.16
239 0.17
240 0.17
241 0.16
242 0.15
243 0.16
244 0.18
245 0.18
246 0.21
247 0.23
248 0.23
249 0.23
250 0.19
251 0.16
252 0.15
253 0.14
254 0.11
255 0.09
256 0.08
257 0.08
258 0.09
259 0.09
260 0.08
261 0.11
262 0.12
263 0.12
264 0.13
265 0.12
266 0.13
267 0.17
268 0.2
269 0.25
270 0.25
271 0.29
272 0.35
273 0.37
274 0.35
275 0.35
276 0.39
277 0.41
278 0.42
279 0.41
280 0.35
281 0.39
282 0.44
283 0.39
284 0.33
285 0.28
286 0.33
287 0.37
288 0.41
289 0.37
290 0.35
291 0.4
292 0.45
293 0.49
294 0.46
295 0.44
296 0.47
297 0.48
298 0.51
299 0.47
300 0.42
301 0.37
302 0.34
303 0.32
304 0.26
305 0.24
306 0.18
307 0.17
308 0.15
309 0.13
310 0.13
311 0.12
312 0.11
313 0.09
314 0.09
315 0.1
316 0.11
317 0.11
318 0.09
319 0.08
320 0.08
321 0.08
322 0.09
323 0.08
324 0.07
325 0.08
326 0.08
327 0.09
328 0.09
329 0.11
330 0.11
331 0.12
332 0.12
333 0.11
334 0.11
335 0.12
336 0.13
337 0.11
338 0.11
339 0.11
340 0.12
341 0.13
342 0.12
343 0.14
344 0.17
345 0.17
346 0.18
347 0.22
348 0.31
349 0.4
350 0.48
351 0.49
352 0.49
353 0.54
354 0.56
355 0.58
356 0.55
357 0.5
358 0.49
359 0.51
360 0.5
361 0.45
362 0.45
363 0.46
364 0.41
365 0.36
366 0.32
367 0.3
368 0.3
369 0.33
370 0.31
371 0.28
372 0.32
373 0.37
374 0.43
375 0.48
376 0.53
377 0.58
378 0.67
379 0.72
380 0.76
381 0.76
382 0.73
383 0.74
384 0.75
385 0.72
386 0.67
387 0.63
388 0.55
389 0.5
390 0.44