Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2P6B9

Protein Details
Accession A0A2T2P6B9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-63LHGKSRAKKGQDCRRHRKKKPDPTTRNFVSBasic
NLS Segment(s)
PositionSequence
37-54KSRAKKGQDCRRHRKKKP
Subcellular Location(s) mito 18, mito_nucl 12.666, cyto_mito 10.666, nucl 6, cyto_nucl 4.666
Family & Domain DBs
Amino Acid Sequences MRRGTMHPRGSMYASPFLPRLLLRFPLRGCTAQLHGKSRAKKGQDCRRHRKKKPDPTTRNFVSAMGVLSTRIPNVQHPPRHIHIYEGISIRSWESCRQRTSRTFSEDSFTHHHSMSSFSTPMVGTAVGEGKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.29
4 0.27
5 0.25
6 0.21
7 0.2
8 0.18
9 0.24
10 0.25
11 0.29
12 0.3
13 0.33
14 0.36
15 0.34
16 0.32
17 0.29
18 0.3
19 0.32
20 0.35
21 0.35
22 0.4
23 0.45
24 0.48
25 0.52
26 0.54
27 0.53
28 0.56
29 0.62
30 0.65
31 0.69
32 0.74
33 0.79
34 0.83
35 0.88
36 0.89
37 0.9
38 0.9
39 0.91
40 0.91
41 0.92
42 0.9
43 0.86
44 0.86
45 0.77
46 0.69
47 0.58
48 0.47
49 0.36
50 0.27
51 0.2
52 0.12
53 0.1
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.09
61 0.17
62 0.24
63 0.27
64 0.3
65 0.36
66 0.38
67 0.43
68 0.4
69 0.34
70 0.32
71 0.31
72 0.31
73 0.27
74 0.24
75 0.19
76 0.2
77 0.18
78 0.15
79 0.15
80 0.18
81 0.24
82 0.3
83 0.35
84 0.39
85 0.46
86 0.51
87 0.58
88 0.58
89 0.57
90 0.55
91 0.5
92 0.51
93 0.45
94 0.43
95 0.4
96 0.36
97 0.31
98 0.28
99 0.28
100 0.23
101 0.27
102 0.25
103 0.24
104 0.21
105 0.18
106 0.2
107 0.19
108 0.19
109 0.16
110 0.12
111 0.08
112 0.1
113 0.13