Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2P854

Protein Details
Accession A0A2T2P854    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-110ETLPRIPRNSPRRKKETALKRFAPHydrophilic
NLS Segment(s)
PositionSequence
93-107PRNSPRRKKETALKR
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MRPLVPIRADYPPALTSHHILHTNIFITSHPTPPRPSIRGLIPAAETCRVYNPYVPPGYDANPSNLPVRHSLAPASEHRVLPHIPHETLPRIPRNSPRRKKETALKRFAPSLTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.22
5 0.25
6 0.25
7 0.24
8 0.24
9 0.23
10 0.22
11 0.2
12 0.17
13 0.13
14 0.17
15 0.18
16 0.23
17 0.24
18 0.25
19 0.28
20 0.33
21 0.4
22 0.36
23 0.37
24 0.34
25 0.34
26 0.38
27 0.36
28 0.31
29 0.26
30 0.25
31 0.23
32 0.21
33 0.18
34 0.12
35 0.14
36 0.15
37 0.14
38 0.16
39 0.16
40 0.2
41 0.2
42 0.2
43 0.19
44 0.19
45 0.2
46 0.2
47 0.18
48 0.17
49 0.17
50 0.19
51 0.19
52 0.19
53 0.19
54 0.18
55 0.21
56 0.19
57 0.18
58 0.17
59 0.16
60 0.19
61 0.19
62 0.23
63 0.23
64 0.22
65 0.22
66 0.24
67 0.23
68 0.21
69 0.25
70 0.23
71 0.21
72 0.23
73 0.26
74 0.27
75 0.32
76 0.37
77 0.38
78 0.38
79 0.42
80 0.5
81 0.57
82 0.65
83 0.7
84 0.74
85 0.74
86 0.77
87 0.81
88 0.81
89 0.82
90 0.81
91 0.81
92 0.77
93 0.73
94 0.71