Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2P1B1

Protein Details
Accession A0A2T2P1B1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
40-64IAFFPIPKKKQKKNTFAKRNATLRSHydrophilic
NLS Segment(s)
PositionSequence
47-52KKKQKK
Subcellular Location(s) nucl 16, cyto 8, mito_nucl 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIHEPDGGLYSDRYGSLRPQRPSFPPFSPPLLPGFIYTAIAFFPIPKKKQKKNTFAKRNATLRSDPIRPAQDMGYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.28
4 0.35
5 0.39
6 0.43
7 0.47
8 0.51
9 0.55
10 0.53
11 0.46
12 0.43
13 0.41
14 0.42
15 0.38
16 0.34
17 0.3
18 0.26
19 0.23
20 0.19
21 0.17
22 0.13
23 0.12
24 0.11
25 0.09
26 0.07
27 0.07
28 0.06
29 0.06
30 0.11
31 0.17
32 0.21
33 0.3
34 0.4
35 0.48
36 0.59
37 0.69
38 0.74
39 0.79
40 0.87
41 0.88
42 0.89
43 0.89
44 0.87
45 0.84
46 0.78
47 0.73
48 0.65
49 0.61
50 0.57
51 0.52
52 0.46
53 0.46
54 0.46
55 0.41
56 0.4