Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2P0E6

Protein Details
Accession A0A2T2P0E6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77HTHTHPPSRNKERKRAVAAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, extr 2
Family & Domain DBs
Amino Acid Sequences MLAKHYHVFPTLSASRLLSLQLVPEKKVIMVRLACMPRGGSGPTPHTMRGPHARSHAHTHTHPPSRNKERKRAVAAAAADATAAGFEIVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.19
5 0.13
6 0.11
7 0.13
8 0.18
9 0.19
10 0.19
11 0.2
12 0.19
13 0.19
14 0.21
15 0.19
16 0.18
17 0.17
18 0.17
19 0.23
20 0.24
21 0.23
22 0.21
23 0.2
24 0.16
25 0.16
26 0.16
27 0.12
28 0.13
29 0.15
30 0.18
31 0.19
32 0.18
33 0.18
34 0.18
35 0.2
36 0.26
37 0.27
38 0.27
39 0.31
40 0.33
41 0.35
42 0.41
43 0.42
44 0.38
45 0.36
46 0.41
47 0.45
48 0.5
49 0.53
50 0.52
51 0.58
52 0.65
53 0.73
54 0.73
55 0.75
56 0.76
57 0.79
58 0.8
59 0.75
60 0.68
61 0.64
62 0.58
63 0.5
64 0.41
65 0.32
66 0.24
67 0.18
68 0.15
69 0.08
70 0.07