Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SDA6

Protein Details
Accession Q7SDA6    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-123EKMAEKMHKKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
36-40KKAFR
49-119EKRAKERQLLAAVKAKEKELKDEKEAERKRRIEALKEKRAKKEEKERYEKMAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG ncr:NCU02640  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSTTTTTQTTSQVETKAVSKPLGMRVNGKQWHAPKKAFRPGSGLTSYEKRAKERQLLAAVKAKEKELKDEKEAERKRRIEALKEKRAKKEEKERYEKMAEKMHKKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.26
5 0.26
6 0.23
7 0.21
8 0.23
9 0.3
10 0.35
11 0.34
12 0.34
13 0.36
14 0.45
15 0.47
16 0.45
17 0.43
18 0.44
19 0.53
20 0.53
21 0.54
22 0.53
23 0.59
24 0.66
25 0.62
26 0.56
27 0.52
28 0.49
29 0.48
30 0.42
31 0.34
32 0.28
33 0.28
34 0.3
35 0.3
36 0.29
37 0.28
38 0.31
39 0.35
40 0.39
41 0.39
42 0.41
43 0.43
44 0.42
45 0.41
46 0.42
47 0.38
48 0.33
49 0.3
50 0.26
51 0.23
52 0.22
53 0.27
54 0.29
55 0.31
56 0.32
57 0.39
58 0.41
59 0.47
60 0.53
61 0.53
62 0.55
63 0.53
64 0.52
65 0.53
66 0.53
67 0.52
68 0.56
69 0.59
70 0.61
71 0.68
72 0.71
73 0.71
74 0.76
75 0.73
76 0.71
77 0.72
78 0.72
79 0.74
80 0.78
81 0.74
82 0.73
83 0.74
84 0.7
85 0.64
86 0.62
87 0.6
88 0.61
89 0.66
90 0.69
91 0.69
92 0.67
93 0.72
94 0.74
95 0.78
96 0.78
97 0.81
98 0.82
99 0.84
100 0.92
101 0.94
102 0.94
103 0.93