Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T2NJC9

Protein Details
Accession A0A2T2NJC9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
132-157AASTTTSKIKKQRKPCKAAKAWMCAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 11.165, nucl 9, cyto_nucl 8.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASPARRCERNKCYTATNECDMAYGGCWDDCATQIPTFTQPICGPAPTLLMAGNYTAPASITMAPSSISSDIPTLASMNSTCSPLWICVDYVAKCGNSSIMYGNCYDTCNPITVTPPPCTKPPVTVTSWPDAASTTTSKIKKQRKPCKAAKAWMCAPADW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.64
4 0.57
5 0.49
6 0.44
7 0.4
8 0.34
9 0.26
10 0.18
11 0.13
12 0.1
13 0.08
14 0.09
15 0.09
16 0.09
17 0.09
18 0.12
19 0.14
20 0.13
21 0.14
22 0.16
23 0.17
24 0.19
25 0.18
26 0.18
27 0.15
28 0.18
29 0.19
30 0.18
31 0.16
32 0.14
33 0.16
34 0.13
35 0.13
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.06
62 0.05
63 0.06
64 0.05
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.1
71 0.1
72 0.11
73 0.09
74 0.08
75 0.09
76 0.13
77 0.12
78 0.13
79 0.14
80 0.13
81 0.12
82 0.12
83 0.11
84 0.09
85 0.09
86 0.1
87 0.1
88 0.11
89 0.12
90 0.13
91 0.13
92 0.14
93 0.13
94 0.13
95 0.13
96 0.14
97 0.14
98 0.13
99 0.15
100 0.2
101 0.23
102 0.24
103 0.28
104 0.28
105 0.3
106 0.34
107 0.32
108 0.32
109 0.34
110 0.36
111 0.36
112 0.41
113 0.43
114 0.43
115 0.43
116 0.37
117 0.32
118 0.28
119 0.24
120 0.2
121 0.18
122 0.17
123 0.24
124 0.26
125 0.32
126 0.41
127 0.5
128 0.56
129 0.65
130 0.73
131 0.76
132 0.84
133 0.88
134 0.89
135 0.88
136 0.89
137 0.87
138 0.85
139 0.78
140 0.75