Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NG72

Protein Details
Accession A0A2T2NG72    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-40RPSARDSGRDRSPRRRSRSPRRSRRSYSPMSGBasic
NLS Segment(s)
PositionSequence
16-33GRDRSPRRRSRSPRRSRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MDSGADTYRPSARDSGRDRSPRRRSRSPRRSRRSYSPMSGAQGAAGYQSYGASRGGGPPRTSEDRSANKESMMQSIRESSQQDRRVYVGNLSYDVKWHHLKDFMRQAGEVLFADVLLLPNGMSKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.51
4 0.6
5 0.64
6 0.69
7 0.77
8 0.77
9 0.8
10 0.83
11 0.84
12 0.86
13 0.91
14 0.91
15 0.91
16 0.91
17 0.92
18 0.89
19 0.88
20 0.86
21 0.82
22 0.76
23 0.71
24 0.65
25 0.57
26 0.51
27 0.4
28 0.31
29 0.23
30 0.18
31 0.11
32 0.08
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.1
42 0.14
43 0.17
44 0.17
45 0.17
46 0.22
47 0.27
48 0.28
49 0.27
50 0.3
51 0.34
52 0.39
53 0.42
54 0.38
55 0.33
56 0.35
57 0.32
58 0.3
59 0.26
60 0.2
61 0.17
62 0.19
63 0.19
64 0.19
65 0.2
66 0.19
67 0.26
68 0.33
69 0.33
70 0.32
71 0.33
72 0.33
73 0.32
74 0.31
75 0.25
76 0.2
77 0.21
78 0.21
79 0.2
80 0.18
81 0.19
82 0.21
83 0.22
84 0.22
85 0.23
86 0.28
87 0.29
88 0.36
89 0.45
90 0.44
91 0.41
92 0.4
93 0.38
94 0.32
95 0.33
96 0.24
97 0.15
98 0.11
99 0.09
100 0.09
101 0.09
102 0.09
103 0.07
104 0.07
105 0.05
106 0.07