Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2NSF4

Protein Details
Accession A0A2T2NSF4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLKRRTKRKKFEEKVVDPHTSBasic
NLS Segment(s)
PositionSequence
4-10RRTKRKK
Subcellular Location(s) mito 19.5, mito_nucl 13.333, nucl 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037685  RBP11  
IPR036603  RBP11-like  
IPR009025  RBP11-like_dimer  
Gene Ontology GO:0005665  C:RNA polymerase II, core complex  
GO:0046983  F:protein dimerization activity  
GO:0001055  F:RNA polymerase II activity  
Pfam View protein in Pfam  
PF13656  RNA_pol_L_2  
CDD cd06926  RNAP_II_RPB11  
Amino Acid Sequences MLKRRTKRKKFEEKVVDPHTSVFTINKEDHTLGNLLQQCLCLMKCVKFAGYNVLNPLESTIKLRIGTDGSVTPKDVLVACMRKTIEDLEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.74
4 0.63
5 0.56
6 0.46
7 0.36
8 0.29
9 0.21
10 0.17
11 0.18
12 0.18
13 0.18
14 0.19
15 0.19
16 0.18
17 0.18
18 0.17
19 0.13
20 0.17
21 0.18
22 0.16
23 0.15
24 0.15
25 0.13
26 0.14
27 0.13
28 0.11
29 0.1
30 0.11
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.19
37 0.19
38 0.19
39 0.18
40 0.18
41 0.18
42 0.16
43 0.18
44 0.12
45 0.1
46 0.12
47 0.12
48 0.14
49 0.14
50 0.15
51 0.15
52 0.15
53 0.15
54 0.14
55 0.16
56 0.17
57 0.18
58 0.19
59 0.18
60 0.16
61 0.17
62 0.16
63 0.15
64 0.18
65 0.23
66 0.22
67 0.27
68 0.27
69 0.27
70 0.28
71 0.28