Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T2N0E9

Protein Details
Accession A0A2T2N0E9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
107-127GPDKSVSKRHRLLRRIGWKRQBasic
NLS Segment(s)
PositionSequence
115-125RHRLLRRIGWK
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MYNRALRRYQEAIKPEHLPTYLPALNTMWGLAALFDRQHQIEDAKLWYSKTLTGYENVKGKDHSTCETLRNNLAALERAQDEVGLLSEELPLQEGGNTGSPASINTGPDKSVSKRHRLLRRIGWKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.43
4 0.37
5 0.31
6 0.27
7 0.29
8 0.27
9 0.23
10 0.23
11 0.2
12 0.2
13 0.19
14 0.18
15 0.1
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.09
24 0.09
25 0.1
26 0.11
27 0.11
28 0.11
29 0.13
30 0.13
31 0.13
32 0.14
33 0.13
34 0.13
35 0.13
36 0.14
37 0.14
38 0.15
39 0.14
40 0.16
41 0.18
42 0.21
43 0.25
44 0.23
45 0.22
46 0.2
47 0.2
48 0.2
49 0.2
50 0.18
51 0.17
52 0.18
53 0.21
54 0.23
55 0.23
56 0.21
57 0.2
58 0.18
59 0.16
60 0.15
61 0.13
62 0.1
63 0.11
64 0.1
65 0.1
66 0.1
67 0.09
68 0.08
69 0.07
70 0.07
71 0.05
72 0.05
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.13
90 0.13
91 0.13
92 0.16
93 0.17
94 0.17
95 0.2
96 0.24
97 0.23
98 0.31
99 0.36
100 0.42
101 0.49
102 0.58
103 0.66
104 0.69
105 0.75
106 0.75
107 0.8